ChemicalBook >> CAS DataBase List >>Aviptadil

Aviptadil

CAS No.
40077-57-4
Chemical Name:
Aviptadil
Synonyms
VIP;VIP【pig】;Apidodil;AVIPTADIL;aviptidal;VIP PORCINE;VIP【rabbit】;VIP USP/EP/BP;Aviptadil Acetate;Aviptadil impurity
CBNumber:
CB9215069
Molecular Formula:
C147H238N44O42S
Molecular Weight:
3325.8
MDL Number:
MFCD00167535
MOL File:
40077-57-4.mol
MSDS File:
SDS
Last updated:2024-04-28 13:35:55

Aviptadil Properties

Density 1.47±0.1 g/cm3(Predicted)
storage temp. −20°C
solubility 1% acetic acid: soluble 0.1%, clear, colorless
form powder
Water Solubility Soluble to 1 mg/ml in water
Sequence His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
InChIKey HEOYHMUESMJFDC-RIWXPGAOSA-N
EWG's Food Scores 1
NCI Dictionary of Cancer Terms vasoactive intestinal peptide; VIP
FDA UNII A67JUW790C

SAFETY

Risk and Safety Statements

WGK Germany  3

Aviptadil price More Price(54)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich V6130 Vasoactive Intestinal Peptide human, porcine, rat synthetic, ≥95% (HPLC), powder 40077-57-4 250μg $189.6 2024-03-01 Buy
Sigma-Aldrich V6130 Vasoactive Intestinal Peptide human, porcine, rat synthetic, ≥95% (HPLC), powder 40077-57-4 0.5mg $577 2024-03-01 Buy
Sigma-Aldrich V3628 Vasoactive Intestinal Peptide human, porcine, rat ≥95% (HPLC), powder 40077-57-4 250μg $439 2024-03-01 Buy
Sigma-Aldrich V3628 Vasoactive Intestinal Peptide human, porcine, rat ≥95% (HPLC), powder 40077-57-4 0.5mg $802 2024-03-01 Buy
Sigma-Aldrich 05-23-2101 Vasoactive Intestinal Peptide, Human, Porcine, and Rat - CAS 40077-57-4 - Calbiochem Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system. 40077-57-4 1mg $274.2 2024-03-01 Buy
Product number Packaging Price Buy
V6130 250μg $189.6 Buy
V6130 0.5mg $577 Buy
V3628 250μg $439 Buy
V3628 0.5mg $802 Buy
05-23-2101 1mg $274.2 Buy

Aviptadil Chemical Properties,Uses,Production

Discovery

VIP is a neuropeptide consisting of 28 aa residues, with wide distribution in the central and peripheral nervous systems. VIP has a broad spectrum of biologic actions, and acts as a neurotransmitter or neuromodulator and also as a hormone. VIP was first discovered as a smooth muscle-relaxant vasodilator peptide in the lung; it was isolated from the porcine intestine in 1970. Its original label as a “candidate gastrointestinal hormone” was soon replaced by its new and apparently true identity as a neuropeptide with neurotransmitter and neuromodulator properties.

Structure

VIP possesses two segments of secondary structures: a random coil structure in the N-terminal region between positions 1 and 9, and a long α-helical structure in the C-terminal region stretching from position 10 to its C-terminus. The primary structure of VIP is highly conserved in vertebrates with complete identity among mammals except for the guinea pig and opossum. Mr 3326, pI >11. VIP is soluble in water to 20mg/mL.
structure of Aviptadil

Gene, mRNA, and precursor

The human VIP gene, VIP, location 6q25.2, contains seven exons. Each exon encodes a distinct functional domain of the VIP precursor. The VIP precursor polypeptide (preproVIP) contains several additional biologically active peptides, including peptide histidine isoleucine (PHI, found in nonhuman mammals), peptide histidine methionine (PHM, the human equivalent of PHI), and peptide histidine valine (PHV, a C-terminally extended form of PHI and PHM).

Synthesis and release

VIP gene expression is stimulated by dibutyryl cAMP and by increased PKC activity induced by tumorpromoting phorbol esters. When acting together, cAMP and phorbol esters synergistically stimulate VIP gene transcription via different sites on the gene.

Receptors

VIP and PACAP share a wide spectrum of biological activity as well as common receptors belonging to the class II of GPCR. Three VIP or PACAP receptor types, which are derived from different genes, are recognized, namely VPAC1, VPAC2, and PAC1. Two of these receptors, VPAC1 and VPAC2, share a high binding affinity in the nanomolar range for VIP and PACAP. A third receptor type, PAC1, has been characterized for its high affinity for PACAP, but low affinity for VIP.

Signal transduction pathway

By binding to VIP, VPAC acts on the Gs protein and activates PKA via elevation of AC activity and production of cAMP (cAMP-dependent pathway). PKA either inhibits phosphorylation of the downstream MAP/ERK kinase or promotes phosphorylation of cAMP response element binding protein (CREB), which finally leads to the inhibition of NF-κB. Meanwhile, studies have also identified a pathway that inhibits the nuclear entry of NF-κB through VPAC signaling, which inhibits IκB phosphorylation (cAMP-independent pathway).

Biological functions

VIP is extensively distributed in central and peripheral tissues, where it acts as a neurotransmitter and neuromodulator.8 The main activity of VIP is vasodilatation. VIP induces the dilation of vessels, which results in increased blood flow, decreased peripheral vascular resistance, and hypotension. While VIP has a suppressive effect on the intestinal smooth muscle, it exerts relaxant effects on the lower esophageal sphincter, the sphincter of Oddi, the anal sphincter, and the bronchial smooth muscle. In the small intestine, VIP facilitates the secretion of electrolytes and aqueous liquid. In the stomach, it inhibits gastric secretion. In the pancreas, VIP facilitates the external secretion of bicarbonic acid and aqueous liquid from pancreatic epithelial cells, and facilitates enzyme secretion from acinar cells. VIP promotes the secretion of both insulin and glucagon in a glucose-dependent manner. VIP is broadly distributed in the central nervous system, especially in the hypothalamus and pituitary anterior lobe, and is associated with the regulation of pituitary hormones. VIP is produced by lymphoid tissue and exerts a wide spectrum of immunological functions, controlling the homeostasis of the immune system through different receptors expressed in various immunocompetent cells. VIP acts as a growth factor. It functions as a proliferative factor in normal tissue cells as well as in cancer cells. VIP might inhibit apoptosis by stimulating the expression of the apoptosis-inhibiting gene Bcl2 or by inhibiting the activity of caspase 3.

Clinical implications

Various diseases have been reported to involve VIP activity, including bronchial asthma, transmission of pain, cluster headaches, Alzheimer’s disease, Parkinson’s disease, and brain injury.

Uses

Pulmonary hypertension;Erectile dysfunction

Uses

Vasoactive Intestinal Peptide human, porcine, rat has been used as an immunogen to analyze the immunohistochemical reactions. It has also been used in cell migration assay.

General Description

Vasoactive intestinal peptide (VIP) is widely distributed inthe body and is believed to occur throughout the gastrointestinaltract. It is a 28-residue polypeptide with structuralsimilarities to secretin and glucagon. It causes vasodilatationand increases cardiac contractibility. VIP stimulates bicarbonatesecretion, relaxes gastrointestinal and othersmooth muscles, stimulates glycogenesis, inhibits gastricacid secretion, and stimulates insulin secretion. Its hormonaland neurotransmitter role has been investigated.

Biochem/physiol Actions

VIP (Vasoactive intestinal peptide) possesses anti-inflammatory and immunomodulatory functions. It controls the pathogenesis of rheumatoid arthritis. It is also involved in neuroblastoma differentiation, and pancreatic insulin secretion. Vip exhibits its function through G-protein coupled receptors. Some of the other important actions of VIP is associated with the digestive, respiratory, cardiovascular and reproductive systems.

Clinical Use

28-peptide that is structurally related to secretin and glucagon. It has a diverse biological actions. It has orphan drug status for the treatment of acute esophageal food impaction.

Clinical Use

Several clinical trials have been reported regarding the use of VIP or its analog for asthma and sarcoidosis. In an open clinical Phase II study, patients with histologically proven sarcoidosis and active disease were treated with nebulized VIP. VIP inhalation was safe and well tolerated, and significantly reduced the production of tumor necrosis factor-α by cells isolated from the bronchoalveolar lavage fluids of these patients.

storage

Store at -20°C

Aviptadil Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 281)Suppliers
Supplier Tel Email Country ProdList Advantage
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
Apextide Co Ltd
+undefined15700198315 senjie.hou@sinopep.com China 71 58
Apeloa production Co.,Limited
+86-19131931000 +86-19131931000 admin@apcl.com.cn China 227 58
Shanghai Yunao International Trade Co., Ltd
+8617621705551 asdf@shanghaihg.cn China 265 58
Anhui Yiao New Material Technology Co., Ltd
+86-199-55145978 +8619955145978 sales8@anhuiyiao.com China 253 58
Henan Tengmao Chemical Technology Co. LTD
+8615238638457 salesvip2@hntmhg.com China 415 58
Zibo Hangyu Biotechnology Development Co., Ltd
+86-0533-2185556 +8617865335152 Mandy@hangyubiotech.com China 11013 58
Nantong Guangyuan Chemicl Co,Ltd
+undefined17712220823 admin@guyunchem.com China 616 58
Sigma Audley
+86-18336680971 +86-18126314766 nova@sh-teruiop.com China 525 58
Shanghai Affida new material science and technology center
+undefined15081010295 2691956269@qq.com China 371 58

Related articles

View Lastest Price from Aviptadil manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
Aviptadil Acetate pictures 2024-05-20 Aviptadil Acetate
40077-57-4
US $30.00 / box 1box 98% 2000kg hebei hongtan Biotechnology Co., Ltd
AVIPTADIL pictures 2024-05-15 AVIPTADIL
40077-57-4
US $0.00 / KG 1KG 99% 1 ton Anhui Yiao New Material Technology Co., Ltd
AVIPTADIL pictures 2024-05-15 AVIPTADIL
40077-57-4
US $0.00 / KG 1KG 99% 1 ton Anhui Yiao New Material Technology Co., Ltd
  • AVIPTADIL pictures
  • AVIPTADIL
    40077-57-4
  • US $0.00 / KG
  • 99%
  • Anhui Yiao New Material Technology Co., Ltd
  • AVIPTADIL pictures
  • AVIPTADIL
    40077-57-4
  • US $0.00 / KG
  • 99%
  • Anhui Yiao New Material Technology Co., Ltd

Aviptadil Spectrum

VIP (HUMAN, RAT, MOUSE, RABBIT, CANINE, PORCINE) VIP (HUMAN, BOVINE, PORCINE, RAT) VIP (HUMAN, PORCINE) VIP, HUMAN, PORCINE, AND RAT VIP (HUMAN, PORCINE) (BOVINE, RAT, CANINE) VIP PORCINE VIP Vasoactive Intestinal Peptide human, porcine, rat,VIP VIP (huMan, Mouse, rat) VIP (28 aMino acids) Vasoactive Intestinal Peptide huMan, porcine, ratVasoactive Intestinal Peptide huM Metformin glycinate AVIPTADIL H-HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2 HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2 HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2 HUMAN, PORCINE, RAT HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 VIP(human,bovine,porcine,rat)Acetate PROLACTIN-RELEASING PEPTIDE (1-310,*(PRR PROLACTIN-RELEASING PEPTIDE (12-31),*(PR UROTENSIN-II, MOUSE PROLACTIN-RELEASING PEPTIDE (1-31),*(PRR human,rat,mouse,rabbit,canine,porcine VIP (Vasoactive Intestinal peptide) vasoactive intestinal polypeptide THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2: TRLRKQMAVKKYLNSILN-NH2 VIP, human, porcine, rat: VIP (28 amino acids) M.W. 3325.84 C147H238N44O42S Vasoactive intestinal octacosapeptide Vasoactive intestinal octacosapeptide【pig】 VIP【pig】 VIP【rabbit】 Aviptadil Acetate VIP, HUMAN, PORCINE, RAT VASOACTIVE INTESTINAL PEPTIDE (HUMAN, BOVINE, PORCINE, RAT) VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE) VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, AND RAT VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE) (BOVINE, RAT, CANINE) VASOACTIVE INTESTINAL PEPTIDE HUMAN, PORCINE, RAT VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, RAT, OVINE VASOACTIVE INTESTINAL PEPTIDE, PORCINE VASOACTIVE INTESTINAL PEPTIDE VIP, (HUMAN, PORCINE, RAT, OVINE) VIP, human, ovine, porcine, rat Vasoactive Intestinal Peptide, Human, Porcine, and Rat - CAS 40077-57-4 - Calbiochem aviptidal Glp-His-Gly-Ala-Ala-Pro-Glu-Cys-Phe-Trp-Lys-Tyr-Cys-Ile(Cys8&Cys13 bridge) Vasoactive Intestinal Peptide (human VASOACTIVE INTESTINAL PEPTIDE (HUMAN; RAT; MOUSE; RABBIT; CANINE; PORCINE) Vasoactive Intestinal Peptide human, porcine, rat, ≥95% (HPLC) Aviptadil Acetate(VIP) Vasoactive intestinal octacosapeptide (swine) Vasoactiveintestinalpeptide(Aviptadil) Aviptadil impurity VIP USP/EP/BP Aviptadil(VIP) acetate VIP (human, rat, mou VIP,Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine)