| Company Name: |
Chemsky（shanghai）International Co.,Ltd.
|
| Tel: |
021-50135380 |
| Email: |
shchemsky@sina.com |
| Products Intro: |
Product Name:Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Lys-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp;Lunasin
Purity:98%+
|
| Company Name: |
Creative Peptides
|
| Tel: |
|
| Email: |
info@creative-peptides.com |
| Products Intro: |
Product Name:Lunasin
Purity:>98% Package:1g; 10g;100g;1kg Remarks:Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog pr
|
|
| | LUNASIN Basic information |
| Product Name: | LUNASIN | | Synonyms: | LUNASIN;Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp;SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | | CAS: | 496823-34-8 | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![LUNASIN Structure]() |
| | LUNASIN Chemical Properties |
| | LUNASIN Usage And Synthesis |
| | LUNASIN Preparation Products And Raw materials |
|