| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:γ-TAC4 (30-61)-NH2??;TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
|
| Company Name: |
Hangzhou Go Top Peptide Biotech
|
| Tel: |
0571-88211921 13355716090 |
| Email: |
Sales@gotopbio.com |
| Products Intro: |
Product Name:γ-TAC4 (30-61)-NH2
Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
|
|
| | γ-TAC4 (30 - 61) - NH2 Basic information |
| Product Name: | γ-TAC4 (30 - 61) - NH2 | | Synonyms: | THR-GLU-ALA-GLU-THR-TRP-GLU-GLY-ALA-GLY-PRO-SER-ILE-GLN-LEU-GLN-LEU-GLN-GLU-VAL-LYS-THR-GLY-LYS-ALA-SER-GLN-PHE-PHE-GLY-LEU-MET-NH2;γ-TAC4 (30 - 61) - NH2;TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2 | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | peptide | | Mol File: | Mol File | ![γ-TAC4 (30 - 61) - NH2 Structure]() |
| | γ-TAC4 (30 - 61) - NH2 Chemical Properties |
| | γ-TAC4 (30 - 61) - NH2 Usage And Synthesis |
| | γ-TAC4 (30 - 61) - NH2 Preparation Products And Raw materials |
|