Product Categories
Country: | United States |
---|---|
Tel: | 16314854226 |
Mobile: | +16314854226 |
E-mail: | |
QQ: | |
Skype: | Chat Now! |
Product Name | MF | CAS | Details |
---|
Receptor tyrosine-protein kinase erbB-2 precursor (369-386) | Details |
Receptor tyrosine-protein kinase erbB-2 (689-697) | Details |
Retinal dehydrogenase 1 (88-96) | Details |
Ribosomal protein S26 (47-61) | Details |
Rho-related GTP-binding protein RhoC (176-185) | Details |
Receptor tyrosine-protein kinase erbB-2 (952-961) | Details |
Regulator of G-protein signaling 5 (74-83) | Details |
Rho guanine nucleotide exchange factor 17 (425-438) | Details |
Receptor tyrosine-protein kinase erbB-2 (754-762) | Details |
RER1 protein (80-91) | Details |
Regulator of G-protein signaling 5 (5-13) | Details |
Rhodopsin Epitope Tag | C??H??N??O?? | Details |
TAG-1 A2 (78-86) | Details |
Telomerase reverse transcriptase (461-469) | Details |
Survivin (80-88) | Details |
Telomerare Reverse Transcriptase (hTRT) (653-661) | Details |
Telomerase reverse transcriptase (672-686) | Details |
SYSMEHFRWGKPS | C??H???N??O??S | Details |
Telomerase reverse transcriptase (540-548) | Details |
Telomerase reverse transcriptase (865-873) | Details |
Telomerase Reverse Transcriptase (674-683) | Details |
TDSP5 | Details |
TAMRA-β-Amyloid (1-42), human | 1802087-80-4 | Details |
SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT)) | Details |
Talin (777-785) | Details |
Telomerase reverse transcriptase (766-780) | Details |
TAG-2 (42-50) | Details |
Serine/threonine-protein kinase B-raf (586-614) | Details |
Serine protease hepsin (191-199) | Details |
Small nuclear ribonucleoprotein Sm D1 (11-19) | Details |
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | Details |
Secernin-1 (196-204) | Details |
Structure-specific endonuclease subunit SLX4 (603-615) | Details |
Survivin (18-27) | Details |
Siyry | C50H71N11O13 | 178561-37-0 | Details |
Serine/threonine-protein kinase mTOR (89-98) | Details |
SSA protein SS-56 (55-64) | Details |
Secretin (5-27) (Porcine) | C115H200N38O34 | 19665-15-7 | Details |
Serine protease hepsin (268-276) | Details |
STh | C79H112N22O30S6 | 118447-40-8 | Details |
Sodium-coupled monocarboxylate transporter 2 (343-356) | Details |
Surface IgG (sA20-Ig) of A20 (106-114) | Details |
Serine protease hepsin (229-237) | Details |
St-Ht31 P | C127H209N29O39 | 252869-81-1 | Details |
Sperm surface protein Sp17 (103-111) | Details |
Sarcoma antigen 1 (715-723) | Details |
Small subunit processome component 20 homolog (626-634) | Details |
Survivin-3A (96-104) | Details |
Ribosome-binding protein 1 (879-887) | Details |
(S)-2-hydroxy-3-(2-methylphenyl)-propionic acid | C10H12O3 | 458528-68-2 | Details |
RPL8 protein (31-41) | Details |
(S)-2-hydroxy-3-(3-methylphenyl)-propionic acid | C10H12O3 | 458528-71-7 | Details |
Protein SSX2 (45-58) | Details |
Protein enabled homolog (443-451) | Details |
Protein SSX2 (41-49) | Details |
Protein SSX2 (101-111) | Details |
Prostatic acid phosphatase (18-26) | Details |
Protein SSX4 (151-170) | Details |
Protein SSX2 (45-59) | Details |
Prostatic acid phosphatase (112-120) | Details |
Protein SSX2 (37-54) | Details |
Protein SSX2 (19-34) | Details |
Protein OS-9 (438-446) | Details |
Protein enabled homolog (502-510) | Details |
Protein phosphatase 1 regulatory subunit 3B (172-180) | Details |
Prostatic acid phosphatase (299-307) | Details |
Rabenosyn-5 (541-552) | Details |
Putative protein product of HMFN1045 (253-264) | Details |
Receptor tyrosine-protein kinase erbB-2 (369-377) | Details |
Receptor tyrosine-protein kinase erbB-2 (654-662) | Details |
Receptor-type tyrosine-protein kinase FLT3 (591-600) | Details |
Protein SSX4 (31-50) | Details |
PSMA-PEG4 | C23H42N4O12 | 2256069-92-6 | Details |
Receptor-type tyrosine-protein phosphatase kappa (667-682) | Details |
(R)-2-hydroxy-3-(2-methylphenyl)-propionic acid | C10H12O3 | 1932808-80-4 | Details |
(R)-2-hydroxy-3-(3-methylphenyl)-propionic acid | C10H12O3 | 374119-33-2 | Details |
PSMA (27-38) | Details |
Ras-related protein Rab-38 (50-58) | Details |
PSMA/PSM-P1 (4-12) | Details |
[pThr3]-CDK5 Substrate | C53H100N15O15P | 1670273-47-8 | Details |
Receptor tyrosine-protein kinase erbB-2 (1023-1032) | Details |
Receptor tyrosine-protein kinase erbB-2 (63-71) | Details |
Receptor tyrosine-protein kinase erbB-2 (391-399) | Details |
Protein timeless homolog (848-856) | Details |
Protein SSX4 (61-80) | Details |
Receptor tyrosine-protein kinase erbB-2 (466-474) | Details |
PSM P2 (711-719) | Details |
Protein SSX4 (51-70) | Details |
Protein SSX4 (41-60) | Details |
Ras-related protein Rab-27A (178-186) | Details |
Receptor tyrosine-protein kinase erbB-2 (435-443) | Details |
Receptor tyrosine-protein kinase erbB-2 (650-658) | Details |
Proto-oncogene PIM1 (191-199) | Details |
Receptor tyrosine-protein kinase erbB-2 (48-56) | Details |
Protein SSX4 (161-180) | Details |
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor 1142-1153 | C72H110N19O33P3 | 141171-54-2 | Details |
Receptor tyrosine-protein kinase erbB-2 (402-410) | Details |
Receptor tyrosine-protein kinase erbB-2 (5-13) | Details |
PSCA (14-22) | Details |
Receptor tyrosine-protein kinase erbB-2 (665-673) | Details |
Product Total: Product Page: | ||||
154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 |