| Identification | Back Directory | [Name]
GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY trifluoroacetate salt | [CAS]
1083433-49-1 | [Synonyms]
S961 S961 trifluoroacetate salt GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY trifluoroacetate salt |
| Chemical Properties | Back Directory | [storage temp. ]
-20°C | [solubility ]
DMSO: 100 mg/mL (20.82 mM);Ethanol: Insoluble | [color ]
white to off-white | [Water Solubility ]
Water: Insoluble | [Sequence]
Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40) |
| Hazard Information | Back Directory | [Uses]
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively[1]. | [References]
[1] Sch?ffer L, et al. A novel high-affinity peptide antagonist to the insulin receptor. Biochem Biophys Res Commun. 2008 Nov 14;376(2):380-3. DOI:10.1016/j.bbrc.2008.08.151 |
|
|