ChemicalBook--->CAS DataBase List--->122613-29-0

122613-29-0

122613-29-0 Structure

122613-29-0 Structure
IdentificationBack Directory
[Name]

H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
[CAS]

122613-29-0
[Synonyms]

PKC fragment
PKC (530-558)
PKC FRAGMENT (530-558)
PROTEIN KINASE C (530-558)
LLYEMLAGQAPFEGEDEDELFQSIMEHNV
LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2
PROTEIN KINASE C FRAGMENT 530-558
SER-PHE-VAL-ASN-SER-GLU-PHE-LEU-LYS-PRO-GLU-VAL-LYS-SER: SFVNSEFLKPEVKS
LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
L-Valinamide, L-leucyl-L-leucyl-L-tyrosyl-L-α-glutamyl-L-methionyl-L-leucyl-L-alanylglycyl-L-glutaminyl-L-alanyl-L-prolyl-L-phenylalanyl-L-α-glutamylglycyl-L-α-glutamyl-L-α-aspartyl-L-α-glutamyl-L-α-aspartyl-L-α-glutamyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-seryl-L-isoleucyl-L-methionyl-L-α-glutam...
L-Valinamide,L-leucyl-L-leucyl-L-tyrosyl-L-α-glutamyl-L-methionyl-L-leucyl-L-alanylglycyl-L-glutaminyl-L-alanyl-L-prolyl-L-phenylalanyl-L-α-glutamylglycyl-L-α-glutamyl-L-α-aspartyl-L-α-glutamyl-L-α-aspartyl-L-α-glutamyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-seryl-L-isoleucyl-L-methionyl-L-α-glutamyl-L-histidyl-L-asparaginyl-
[Molecular Formula]

C148H221N35O50S2
[MDL Number]

MFCD00133793
[MOL File]

122613-29-0.mol
[Molecular Weight]

3354.67
Chemical PropertiesBack Directory
[storage temp. ]

−20°C
[form ]

powder
[color ]

white
[Water Solubility ]

Soluble in water
Safety DataBack Directory
[WGK Germany ]

3
Hazard InformationBack Directory
[Uses]

Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption[1].
[References]

[1] Moonga BS, et al. Effects of peptide fragments of protein kinase C on isolated rat osteoclasts. Exp Physiol. 1998 Nov;83(6):717-25. DOI:10.1113/expphysiol.1998.sp004153
122613-29-0 suppliers list
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 18156095617 , 18156095617
Website: http://www.cellmano.com/
Company Name: career henan chemical co
Tel: +86-0371-86658258 +8613203830695 , +8613203830695
Website: www.coreychem.com
Company Name: Zhejiang J&C Biological Technology Co.,Limited
Tel: +1-2135480471
Website: https://www.sarms4muscle.com
Company Name: Hangzhou Go Top Peptide Biotech
Tel: 0571-88211921
Website: http://www.gotopbio.com/
Company Name: Chengdu Youngshe Chemical Co., Ltd.
Tel: +8618108235634 , +8618108235634
Website: http://www.youngshechem.com/
Company Name: LEON (NANJING) BIOTECHNOLOGY CO., LTD.
Tel: +8615051830413 , +8615051830413
Website: http://www.njleonbiotech.com
Company Name: 3B Pharmachem (Wuhan) International Co.,Ltd.  
Tel: 821-50328103-801 18930552037
Website: www.chemicalbook.com/ShowSupplierProductsList13285/0_EN.htm
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Website: http://www.glschina.com/
Company Name: Shanghai Hanhong Scientific Co.,Ltd.  
Tel: 021-54306202 13764082696
Website: https://www.hanhongsci.com
Company Name: Chemsky (shanghai) International Co.,Ltd  
Tel: 021-50135380
Website: www.shchemsky.com
Company Name: Cellmano Biotech Limited  
Tel: 0551-65326643 18156095617
Website: https://www.cellmano.com
Company Name: Nanjing Leon Biological Technology Co., Ltd.  
Tel: 17705183659
Website: www.njleonbiotech.com
Company Name: Nanjing Peptide Biotech Ltd.  
Tel: 025-58361106-805 15951641583
Website: http://www.njpeptide.com
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.  
Tel: 0571-87213919
Website: http://peptidego.com
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.  
Tel: meitaochem@126.com
Website: www.chemicalbook.com/ShowSupplierProductsList31244/0_EN.htm
Company Name: Chengdu Peter-like Biotechnology Co., Ltd.  
Tel: 18108052721
Website: https://www.weikeqi-biotech.com/
Company Name: Nanjing chengqimei Biotechnology Co., Ltd  
Tel: 19850819832
Website: www.chemicalbook.com/ShowSupplierProductsList398701/0_EN.htm
Company Name: Gill polypeptide biopharmaceutical (dalian) co., LTD  
Tel: 021-61263455 13167021076
Website: www.chemicalbook.com/ShowSupplierProductsList295114/0_EN.htm
Tags:122613-29-0 Related Product Information
113731-96-7 121545-65-1 105802-82-2 121284-21-7 159939-84-1

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.