ChemicalBook--->CAS DataBase List--->124584-08-3

124584-08-3

124584-08-3 Structure

124584-08-3 Structure
IdentificationBack Directory
[Name]

BNP-32 (HUMAN)
[CAS]

124584-08-3
[Synonyms]

BNP HUMAN
Nesiritide
BNP-32 (HUMAN)
BNP (1-32), HUMAN
Nesiritide (BNP-32)
Brain natriuretic pe
Nesiritide [USAN:INN]
BNP-32 (HUMAN) USP/EP/BP
BNP-32 (human) hydrochloride
BRAIN NATRIURETIC PEPTIDE, HUMAN
124584-08-3 Nesiritide [USAN:INN]
BRAIN NATRIURETIC PEPTIDE-32 (HUMAN)
BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN
BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN)
B-TYPE (BRAIN) NATRIURETIC PEPTIDE-32 (HUMAN)
Brain Natriuretic Peptide (BNP) (1-32), human
Brain Natriuretic Peptide-32 (huMan), Nesiritide
Nesiritide,Brain Natriuretic Peptide-32 human,BNP-32, >98%
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26)
BNP-32 (huMan) Brain Natriuretic Peptide-32 (huMan), Nesiritide
SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS
H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH
H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26)
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH Acetate salt (Disulfide bond)
L-Histidine, L-seryl-L-prolyl-L-lysyl-L-methionyl-L-valyl-L-glutaminylglycyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-lysyl-L-methionyl-L-α-aspartyl-L-arginyl-L-isoleucyl-L-seryl-L-seryl-L-seryl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-lysyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-,...
[EINECS(EC#)]

1312995-182-4
[Molecular Formula]

C143H244N50O42S4
[MDL Number]

MFCD00133149
[MOL File]

124584-08-3.mol
[Molecular Weight]

3464.04
Chemical PropertiesBack Directory
[density ]

1.52±0.1 g/cm3(Predicted)
[RTECS ]

EE1534000
[storage temp. ]

−20°C
[form ]

powder
[color ]

White to off-white
[Water Solubility ]

Soluble in water at 1mg/ml
[Sequence]

H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26)
[CAS DataBase Reference]

124584-08-3
Safety DataBack Directory
[WGK Germany ]

3
Hazard InformationBack Directory
[Description]

Nesiritide was introduced in the US as a new intravenous treatment for patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity. Nesiritide is the first human recombinant form of the potent vasodilatory B-type natriuretic peptide (also known as brain natriuretic peptide), a naturally occurring 32 amino acid peptide with a disulfide-bonded 17 amino acid ring structure. Nesiritide binds to the Atype natriuretic peptide receptor on the surface of endothelial and smooth muscle cells stimulating production of the second messenger cGMP which mediates predominantly vascular smooth muscle cell relaxation. It also facilitates the elimination of sodium and water by the kidney and decreases the secretion of certain hormones, such as adrenalin, angiotensin II, aldosterone and endothelin, which provoke long-term detrimental effects including blood vessel constriction and blood pressure elevation. In clinical trials with heart failure patients, nesidtide dose-dependently reduced pulmonary capillary wedge pressure, right atrial pressure and systemic vascular resistance and increased cardiac index without affecting heart rate. The major adverse effect observed was dose-dependent hypotension. In a phase III comparative trial, nesiritide was found to be superior to iv. nitroglycerine in its haemodynamic effects as well as easier to administer and better tolerated. Nesiritide is cleared by proteolytic cleavage by the enzyme neutral endopeptidase NEP24.11 and by binding to the C-type natriuretic peptide receptor followed by endocytosis and intracellular lysosomal hydrolysis. Since it has a short half-life (18 min), nesiritide is administered as a 21μg/kg bolus infusion followed by a continuous maintenance infusion at 0.011μg/kg/min usually over 24-48 hours.
[Originator]

Scios (US)
[Uses]

Treatment of congestive heart failure (renin-angiotensin system antagonist).
[Brand name]

Natrecor (Biochemie, Austria).
[General Description]

The gene encoding brain natriuretic peptide-32 (BNP-32) is localized on human chromosome 1p36.22. It is implicated in several biological functions such as diuresis, natriuresis, hypotensive action and inhibition of aldosterone secretion. BNP-32 acts as a potential biomarker of high left ventricular-diastolic pressure in patients with symptomatic left ventricular (LV) dysfunction. Elevated expression of this protein is observed in acute myocardial infarction (AMI) patients.
[Biological Activity]

Control peptide for Brain Natriuretic Peptide Antibody (BML-BA1117). Blocks antibody reactivity at 100 nmol/ml diluted antiserum.
[Biochem/physiol Actions]

Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.
[storage]

Store at -20°C
124584-08-3 suppliers list
Company Name: Shandong Huizhihan Supply Chain Co., Ltd
Tel: +86-13363081709 +86-13363000288 , +86-13363000288
Website: www.chemicalbook.com/manufacturer/shandong-huizhihan-supply-chain-25414/
Company Name: ZHENGZHOU JIUYI TIME NEW MATERIALS CO,.LTD
Tel: +86-13017695106 +86-13676922317 , +86-13676922317
Website:
Company Name: Sinoway Industrial co., ltd.
Tel: +86-0592-5800732 +86-13806035118 , +86-13806035118
Website: www.china-sinoway.com/
Company Name: Adachibio Inc.
Tel: +8108027837258 , +8108027837258
Website: www.adachibio.com/
Company Name: Henan Tianfu Chemical Co.,Ltd.
Tel: +86-0371-55170693 +86-19937530512 , +86-19937530512
Website: https://www.tianfuchem.com/
Company Name: Shenzhen Nexconn Pharmatechs Ltd
Tel: +86-755-89396905 +86-15013857715 , +86-15013857715
Website: www.chemicalbook.com/ShowSupplierProductsList31188/0_EN.htm
Company Name: Hubei Jusheng Technology Co.,Ltd.
Tel: 18871490254
Website: www.hubeijusheng.com
Company Name: BOC Sciences
Tel: +1-631-485-4226
Website: https://www.bocsci.com/
Company Name: Alchem Pharmtech,Inc.
Tel: 8485655694
Website: www.chemicalbook.com/ShowSupplierProductsList454175/0_EN.htm
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 18156095617 , 18156095617
Website: http://www.cellmano.com/
Company Name: CONIER CHEM AND PHARMA LIMITED
Tel: +8618523575427 , +8618523575427
Website: http://www.conier.com/
Company Name: Hebei Yanxi Chemical Co., Ltd.
Tel: +8618531123677 , +8618531123677
Website: www.chemicalbook.com/manufacturer/hebei-yanxi-chemical-283/
Company Name: Hubei Ipure Biology Co., Ltd
Tel: +8613367258412 , +8613367258412
Website: http://www.ipurechemical.com
Company Name: Career Henan Chemica Co
Tel: +86-0371-86658258 +8613203830695 , +8613203830695
Website: www.coreychem.com/
Company Name: HONG KONG IPURE BIOLOGY CO.,LIMITED
Tel: 86 18062405514 18062405514 , 18062405514
Website: www.chemicalbook.com/ShowSupplierProductsList1523002/0_EN.htm
Company Name: Dideu Industries Group Limited
Tel: +86-29-89586680 +86-15129568250 , +86-15129568250
Website: https://www.dideu.com
Company Name: AFINE CHEMICALS LIMITED
Tel: +86-0571-85134551
Website: www.afinechem.com/index.html
Company Name: Wuhan Fortuna Chemical Co., Ltd
Tel: +86-027-59207850 +86-13986145403; , +86-13986145403;
Website: http://www.fortunachem.com/
Tags:124584-08-3 Related Product Information
114471-18-0 79517-01-4 204656-20-2 131741-08-7 107452-89-1 113274-56-9 9034-50-8 103129-82-4 138402-11-6 16941-32-5 49745-95-1 78415-72-2 54063-53-5 65141-46-0 75438-57-2 75847-73-3 39562-70-4 83915-83-7

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.