| Identification | Back Directory | [Name]
EXENDIN-4 (3-39) | [CAS]
196109-31-6 | [Synonyms]
EXENDIN (3-39)
EXENDIN-4 (3-39)
M.W. 3992.42 C176H272N46O58S
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
H-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 | [Molecular Formula]
C176H272N46O58S | [MDL Number]
MFCD01323257 | [MOL File]
196109-31-6.mol | [Molecular Weight]
3992.38 |
| Chemical Properties | Back Directory | [storage temp. ]
-15°C | [Sequence]
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 | [InChIKey]
ZCYIPGKMSDDSFW-TYVQEZQOSA-N |
| Hazard Information | Back Directory | [Uses]
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2]. | [in vivo]
GLP-1 (i.p.; 5 μg/kg) increases circulating corticosterone and aldosterone levels[2]. | Animal Model: | Rats[2] | | Dosage: | 5 μg/kg | | Administration: | Intraperitoneal injections | | Result: | Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels. |
| [References]
[1] David Parkes, et al. Pharmacokinetic actions of exendin-4 in the rat: Comparison with glucagon-like peptide-1. (2001), 53(4), 260–267.
[2] Affiliations, et al. GLP-1(7-36)-amide and Exendin-4 stimulate the HPA axis in rodents and humans. Endocrinology. 2010 Jun;151(6):2629-40. DOI:10.1210/en.2009-0915 |
|
| Company Name: |
BOC Sciences
|
| Tel: |
1-631-485-4226; 16314854226 |
| Website: |
https://www.bocsci.com |
|