Chinese Japanese Germany Korea
ChemicalBook >> CAS DataBase List >>CART (55-102) (RAT)

CART (55-102) (RAT)

CART (55-102) (RAT) Structure
CART (55-102) (RAT) structure
CAS No.
209615-79-2
Chemical Name:
CART (55-102) (RAT)
Synonyms
CART (55-102);CART (RAT, 55-102);CART (55-102) (RAT);CART, MOUSE/RAT, (55-102);CARP, MOUSE/RAT, (55-102);CART(55-102)(rat) acetate;CART Fragment 55-102 rat;CART PEPTIDE (AA 55-102), RAT;CART Fragment 55-102 human;COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT
CBNumber:
CB0218173
Molecular Formula:
C226H367N65O65S7
Molecular Weight:
5259.18368
MDL Number:
MFCD01865992
MOL File:
209615-79-2.mol
MSDS File:
SDS
TDS File:
TDS
Last updated:2026-09-12 18:47:39
Request For Quotation

CART (55-102) (RAT) Properties

storage temp. -15°C
form Solid
color White to off-white
Water Solubility Soluble to 1 mg/ml in Water
Sequence Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47)

CART (55-102) (RAT) price More Price(26)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Usbiological 546061 Cocaine And Amphetamine Regulated Transcript PurifiedbyProteinA/Gaffinitychromatography. 200ul $559 2026-06-03 Buy
Biosynth PCA-4351-S CART (Rat, 55-102) 209615-79-2 0.1mg $1275.31 2026-06-04 Buy
Biosynth FC109275 CART (55-102) (rat) 209615-79-2 0.5mg $649 2026-06-04 Buy
Biosynth FC109275 CART (55-102) (rat) 209615-79-2 1mg $843.7 2026-06-04 Buy
Biosynth FC109275 CART (55-102) (rat) 209615-79-2 2mg $1038.4 2026-06-04 Buy
Product number Packaging Price Buy
546061 200ul $559 Buy
PCA-4351-S 0.1mg $1275.31 Buy
FC109275 0.5mg $649 Buy
FC109275 1mg $843.7 Buy
FC109275 2mg $1038.4 Buy

CART (55-102) (RAT) Chemical Properties,Uses,Production

Structure

CART peptides of different lengths have been found in various tissues. The rat central nervous system contains CART55–102 and CART62–102 fragments. In the periphery, longer products are generated in addition to CART55–102. Adrenal glands in the rat produce two peptides, CART1–89 and CART10–89. The most widely studied peptides are CART55–102 and CART62–102 . Both peptides contain a cysteine-knot motif, which is critical for the biological activity of the hormone. The human CART42–89 corresponds to the rodent CART55–102. Genome studies have revealed that fish have multiple CART genes. Two different goldfish CART55–102 (Goldfish I and II) genes present high homology with their mammalian counterparts in their C-terminal end region.
CART (55-102) (RAT)

Gene, mRNA, and precursor

The human CART gene, CARTPT, located in the 5q13.2 region, consists of two introns and three exons. Due to alternative splicing, the rodent CART mRNA produces two spliced variants of proCART. Long and short forms encode a 102 aa sequence or an 89 aa sequence, respectively. Only the latter has been found in humans.

Synthesis and release

In hypothalamic explants, the neuropeptide Y (NPY) significantly increased the release of CART (55–102) immunoreactivity. In vivo experiments showed that leptin administration induces Fos expression in hypothalamic CART neurons. NPY and CART are coexpressed in the same neurons in the dorsomedial hypothalamus in chronic obesity. These neurons are activated by peripheral leptin treatment in diet-induced obesity. Thus, CART peptides are anorexigenic and closely associated with leptin and NPY, two important food intake regulators. CART is also released in response to repeated dopamine release in the nucleus accumbens.

Receptors

Although CART-responsive cell lines or neurons were reported, the receptor for CART has not been clarified yet. It is speculated that CART55–102 and CART62–102 do not share the same receptor, as they show different physiological activities in vivo. In 2020, CART55-102 was suggested to be a ligand of an orphan GPCR, GPR160, from biological assays. Further pharmacology would be required on GPR160 and CART for confirmation. The signal transduction pathway is predicted to be mainly coupled to the Gi/o protein and to stimulate ERK1/2 activation or inhibit calcium signaling.

Biological functions

In the goldfish, the central administration of human CART has been shown to decrease food intake. In mammals, CART modulates various physiological processes such as feeding, energy expenditure, stress control, and endocrine secretion.

Clinical implications

In an obese 10-year-old boy, where the onset of obesity was at the age of 2, a G-to-C transversion at nucleotide 729 of the CART gene was identified, resulting in missense mutation, a leucine to phenylalanine substitution at codon 34 (L34F). This mutation affects posttranslational processing and causes bioactive CART deficiency in the serum. The L34F mutation segregated with severe obesity over three generations in this family, and was not identified in the control population. The affected subjects demonstrated reduced resting energy expenditures. Further, sequence variability in the CART gene has been identified as being related to obesity in several hundred French subjects.

Uses

CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior[1][2].

General Description

CART, so named because of upregulation by cocaine and amphetamine, is thought to be involved in the regulation of feeding and stress. However, its cognate receptor has not yet been identified. In the 1980s, a fragment of the CART peptide was identified in an extract of ovine hypothalamus. Fifteen years later, the level of CART mRNA was found to increase in the rat striatum after acute administration of cocaine and amphetamine. Subsequently, in 1999, CART peptides were extracted and sequenced from the rat, and it was found that two different forms (CART55–102 and CART62–102) were present.

storage

Store at -20°C

References

[1] H Volkoff, et al. Effects of CART Peptides on Food Consumption, Feeding and Associated Behaviors in the Goldfish, Carassius Auratus: Actions on Neuropeptide Y- And Orexin A-induced Feeding. Brain Res. 2000 Dec 22;887(1):125-33. DOI:10.1016/s0006-8993(00)03001-8
[2] Shigeyuki Chaki, et al. Cocaine- And Amphetamine-Regulated Transcript Peptide Produces Anxiety-Like Behavior in Rodents. Eur J Pharmacol. 2003 Mar 7;464(1):49-54. DOI:10.1016/s0014-2999(03)01368-2

CART (55-102) (RAT) Preparation Products And Raw materials

Raw materials

Preparation Products

CART (55-102) (RAT) Suppliers

Global( 71)Suppliers
Supplier Tel Email Country ProdList Advantage
3B Pharmachem (Wuhan) International Co.,Ltd. 18930552037 3bsc@sina.com China 15813 69
GL Biochem (Shanghai) Ltd 21-61263452 13641803416 ymbetter@glbiochem.com China 9981 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202 13764082696 info@hanhongsci.com China 42917 64
Chemsky (shanghai) International Co.,Ltd 021-50135380 shchemsky@sina.com China 15350 60
Cellmano Biotech Limited 0551-65326643 18156095617 info@cellmano.com China 1010 55
Hangzhou Sage Chemical Co., Ltd. +86057186818502 13588463833 info@sagechem.com China 10265 58
Wuxi Zhongkun Biochemical Technology Co., Ltd. 0510-85629785 18013409632; sales@reading-chemicals.com China 15165 58
Nanjing Leon Biological Technology Co., Ltd. 025-84523390 -127; 17705183659 sales@njleonbiotech.com China 5501 55
Nanjing Peptide Biotech Ltd. 025-58361106-805 15951641583 zhao.xu@njpeptide.com China 9976 55
Chengdu Youngshe Chemical Co., Ltd. +86-17380623303 Caroline@youngshechem.com China 4725 58
Supplier Advantage
3B Pharmachem (Wuhan) International Co.,Ltd. 69
GL Biochem (Shanghai) Ltd 64
Shanghai Hanhong Scientific Co.,Ltd. 64
Chemsky (shanghai) International Co.,Ltd 60
Cellmano Biotech Limited 55
Hangzhou Sage Chemical Co., Ltd. 58
Wuxi Zhongkun Biochemical Technology Co., Ltd. 58
Nanjing Leon Biological Technology Co., Ltd. 55
Nanjing Peptide Biotech Ltd. 55
Chengdu Youngshe Chemical Co., Ltd. 58

View Lastest Price from CART (55-102) (RAT) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
CART (55-102) (RAT) pictures 2020-02-14 CART (55-102) (RAT)
209615-79-2
 $7.00 1KG 99% 100KG Career Henan Chemical Co

209615-79-2(CART (55-102) (RAT))Related Search:

Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)dysprosium(III) Dichloro(ethylenediamine)platinum(II) 2,4-Pentanedione, silver derivative N-Butylisocyanide Methyl isocyanoacetate
1,1,3,3-Tetramethylbutyl isocyanide tert-Butyl isocyanide Phenylselenol Ferric acetylacetonate COCAINE
Tosylmethyl isocyanide Benzyl isocyanide Cupric acetylacetonate COBALT(II) ACETYLACETONATE SALCOMINE
Aluminum acetylacetonate Ethyl isocyanoacetate Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)europium(III)

1of4

CART, MOUSE/RAT, (55-102) CART (55-102) CART PEPTIDE (AA 55-102), RAT CART (RAT, 55-102) COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT COCAINE-AND AMPHETAMINE-REGULATED TRANSCRIPT (55-102) (RAT) COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT (RAT, 55-102) COCAINE- AND AMPHETAMINE RELATED TRANSCRIPT, MOUSE/RAT, (55-102) IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (DISULFIDE BRIDGE: 74-94,68-86 AND 88-101) ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYA-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHELEU-LEU-LYS-CYS-LEU-OH H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU-OH H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU-OH (DISULFIDE BRIDGE: 74-94, 68-86, AND 88-101) ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCDISULFIDE BRIDG CART Fragment 55-102 human CART Fragment 55-102 rat L-Isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanylglycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysylglycyl-L-alanyl-L-arginyl-L-isoleucylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginylglycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine cyclic (14-32),(20-40),(34-47)-tris(disulfide) CARP, MOUSE/RAT, (55-102) CART (55-102) (RAT) CART (55-102) (rat) H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) L-Leucine,L-isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-α-glutamyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-α-aspartyl-L-alanylglycyl-L-α-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysylglycyl-L-alanyl-L-arginyl-L-isoleucylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-arginylglycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-,cyclic(14→32),(20→40),(34→47)-tris(disulfide) CART(55-102)(rat) acetate 209615-79-2 C226H367N65O65S7 C225H365N65O65S7 peptide