ChemicalBook >> CAS DataBase List >>LL-37

LL-37

CAS No.
154947-66-7
Chemical Name:
LL-37
Synonyms
II37 Peptide;LL-37, LL37, CAMP;Cathelicidin LL-37;LL-37 5mg (CAP-18);LL-37 human acetate;LL-37 (LL37)PEPTIDE;LL-37 (Cathelicidin);LL37 (Human cathelicidin);Cathelicidin LL 37 (human);LL-37 ( Human) (0.1mg vial)
CBNumber:
CB02603131
Molecular Formula:
C205H340N60O53
Molecular Weight:
0
MDL Number:
MFCD09264694
MOL File:
Mol file
Last updated:2026-02-02 18:10:39
Product description Number Pack Size Price
LL-37 (trifluoroacetate salt) ≥95% 24461 500μg $167
LL-37 (trifluoroacetate salt) ≥95% 24461 1mg $315
LL37 B7771 1mg $366
LL37 B7771 500ug $193

LL-37 Properties

solubility Water: 1 mg/ml
form A lyophilized powder
color White to off-white
Water Solubility Soluble to 1 mg/ml in water
Sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
InChIKey POIUWJQBRNEFGX-XAMSXPGMSA-N
FDA UNII 3DD771JO2H

LL-37 price More Price(4)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Cayman Chemical 24461 LL-37 (trifluoroacetate salt) ≥95% 154947-66-7 500μg $167 2023-06-20 Buy
Cayman Chemical 24461 LL-37 (trifluoroacetate salt) ≥95% 154947-66-7 1mg $315 2023-06-20 Buy
ApexBio Technology B7771 LL37 154947-66-7 1mg $366 2021-12-16 Buy
ApexBio Technology B7771 LL37 154947-66-7 500ug $193 2021-12-16 Buy
Product number Packaging Price Buy
24461 500μg $167 Buy
24461 1mg $315 Buy
B7771 1mg $366 Buy
B7771 500ug $193 Buy

LL-37 Chemical Properties,Uses,Production

Structure

The structure of LL-37 in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2–31 followed by a disordered C-terminal tail. The helical bend is located between residues Gly-14 and Glu-16. Similar chemical shifts and 15N nuclear Overhauser effect (NOE) patterns of the peptide in complex with di octanoyl phosphatidylglycerol (D8PG) micelles indicate a similar structure. The aromatic rings of Phe-5, Phe-6, Phe-17, and Phe-27 of LL-37, as well as arginines, showed intermolecular NOE cross-peaks with D8PG, providing direct evidence for the association of the entire amphipathic helix with anionic lipid micelles. The structure of LL-37 serves as a model for understanding the structure and function relationship of homologous primate cathelicidins[5].

Description

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Uses

L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.

Origin

Mammalian AMPs belong to the defensin and cathelicidin families. So far, there is a unique cathelicidin peptide found in 1995 and called human cationic antimicrobial peptide (hCAP18). Its active part starts with double leucine and consists of 37-amino acids at the C-terminus, so which is called LL-37.

benefits

LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity.  Significantly boosts immune function; Fights inflammation; Prevents cancer progression; Accelerates wound healing; Lowers the risk of heart disease; Prevents lung injury; Promotes bone repair.

Biological Activity

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Side effects

LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following:
Increased inflammation
Induction of autoimmune disease
Depression
Damage to sperm surface membranes

storage

Store at -20°C

References

[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823
[2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733
[3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147
[4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035
[5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.

LL-37 Preparation Products And Raw materials

Raw materials

Preparation Products

LL-37 Suppliers

Global( 156)Suppliers
Supplier Tel Email Country ProdList Advantage
DEI MEI YI YAO KE JI LLC
+852-52854821 +852-52854821 cici71684@gmail.com China 879 58
Shanghai Getian Industrial Co., LTD
+86-15373193816 mike@ge-tian.com China 269 58
Strong peptide cross-border e-commerce Co. LTD
+undefined13930052870 qt01@qiangtaipharm.com China 84 58
Qingdao Xinli Technology Development Co., Ltd.
+8616632313095 xinlikeji01@qdxlchem.com China 124 58
Shandong Huizhihan Supply Chain Co., Ltd
+86-13363081709 +86-13363000288 3957328362@qq.com China 117 58
Kebeilai Pharmaceutical Biotech Co., Ltd.
+86-18240866958 wangjasmine7289@gmail.com China 1022 58
Ningbo Qingteng Plastic Cost.,Ltd.
15383911577 admin@nbqingteng.com China 341 58
RongNa Biotechnology Co.,Ltd
+86-86-13583358881 +8618560316533 Brad@rongnabiotech.com China 3378 58
Shanghai Yunao International Trade Co., Ltd
+8617621705551 asdf@shanghaihg.cn China 264 58
Wuhan Han Sheng New Material Technology Co.,Ltd
+8617798174412 admin01@hsnm.com.cn China 2097 58

Related articles

View Lastest Price from LL-37 manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
LL-37 5mg (CAP-18) pictures 2026-02-16 LL-37 5mg (CAP-18)
154947-66-7
US $30.00-10.00 / kit 1kit 99% 10000kits Shenzhen Aoxi Technology Co., Ltd.
LL-37 (LL37)PEPTIDE pictures 2026-02-16 LL-37 (LL37)PEPTIDE
154947-66-7
US $30.00-10.00 / kit 1kit 99% 10000kits Shenzhen Aoxi Technology Co., Ltd.
LL-37 pictures 2026-02-16 LL-37
154947-66-7
US $1.00 / g 1g 99% 100kg RongNa Biotechnology Co.,Ltd
  • LL-37 pictures
  • LL-37
    154947-66-7
  • US $1.00 / g
  • 99%
  • RongNa Biotechnology Co.,Ltd
Antibacterial Protein LL-37 (huMan), LL37, CAMP H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH Antibacterial Protein LL-37 (human) LL-37 (trifluoroacetate salt) [LL-37, 37 aa] Cathelicidin LL 37 (human) LL-37, LL37, CAMP LL-37 human acetate Cathelicidin LL-37 Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37 II37 Peptide LL37 (Human cathelicidin) LL-37, Antimicrobial Peptide, human - 1 mg LL-37 5mg (CAP-18) LL-37 ( Human) (0.1mg vial) LL-37 (Cathelicidin) LL-37 (LL37)PEPTIDE 154947-66-7 C205H340N60O53