ChemicalBook >> CAS DataBase List >>CRF (OVINE)

CRF (OVINE)

CAS No.
9015-71-8
Chemical Name:
CRF (OVINE)
Synonyms
CRF;CRH;CRF, CRH;CRF (OVINE);CRF (hormone);Corticoliberin;Acth releasing factor;Acth-releasing factor;Acth releasing hormone;Acth-releasing hormone
CBNumber:
CB0680088
Molecular Formula:
C205H339N59O63S1
Molecular Weight:
4670.31
MDL Number:
MFCD00286536
MOL File:
Mol file
MSDS File:
SDS
TDS File:
TDS
Last updated:2026-04-24 14:58:10
Product description Number Pack Size Price
Corticotropin Releasing Factor sheep ≥95% (HPLC) C3167 250μg $558
Corticotropin Releasing Factor sheep ≥95% (HPLC) C3167 0.5mg $975
Corticotropin Releasing Factor sheep ≥95% (HPLC) C3167 1mg $1710
CRH Purifiedbyimmunoaffinitychromatography. 559377 50ul $509
CRH Purifiedbyimmunoaffinitychromatography. 559377 100ul $708

CRF (OVINE) Properties

storage temp. −20°C
form Solid
FDA UNII 305OE8862Y
NCI Drug Dictionary corticotropin-releasing hormone
UNSPSC Code 12352200
NACRES NA.32

SAFETY

Risk and Safety Statements

PPE Eyeshields, Gloves, type N95 (US)
WGK Germany  3
Storage Class 11 - Combustible Solids

CRF (OVINE) price More Price(33)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich C3167 Corticotropin Releasing Factor sheep ≥95% (HPLC) 9015-71-8 250μg $558 2026-04-30 Buy
Sigma-Aldrich C3167 Corticotropin Releasing Factor sheep ≥95% (HPLC) 9015-71-8 0.5mg $975 2026-04-30 Buy
Sigma-Aldrich C3167 Corticotropin Releasing Factor sheep ≥95% (HPLC) 9015-71-8 1mg $1710 2026-04-30 Buy
Usbiological 559377 CRH Purifiedbyimmunoaffinitychromatography. 50ul $509 2026-06-03 Buy
Usbiological 559377 CRH Purifiedbyimmunoaffinitychromatography. 100ul $708 2026-06-03 Buy
Product number Packaging Price Buy
C3167 250μg $558 Buy
C3167 0.5mg $975 Buy
C3167 1mg $1710 Buy
559377 50ul $509 Buy
559377 100ul $708 Buy

CRF (OVINE) Chemical Properties,Uses,Production

Discovery

The first evidence of a hypothalamic corticotropinreleasing substance was reported in 1955.The presence of a corticotropin-releasing hormone (CRH) was first reported in the ovine hypothalamus in 1981. Subsequently, CRH was found in the human, mouse, rat, pig, amphibian (Xenopus), teleost fish, cartilaginous fish, and lamprey. Novel members of the CRH family, CRH26,  and teleocortin (Tcn), have recently been reported in vertebrates (except teleosts and placental mammals) and the medaka, respectively.

Properties

Human/mouse/rat CRH: Mr 4758; pI 5.1. CRH peptides are freely soluble in water. The oxidation of methionine at position 21 remarkably decreases the activity of CRH.

Receptors

Three types of CRH receptors have been identified.  They belong to the family of seven-transmembrane-domain GPCRs and activate AC. Type-1 (CRHR1) and type-2 (CRHR2) receptors were identified in mammals, chicken, Xenopus, and teleosts. The type-3 receptor (CRHR3) was found in catfish. In mammals, the CRHR1 gene consists of 13 exons and 12 introns. The CRHR2 gene in humans consists of 12 exons and 11 introns, and three splice variants (CRHR2α, 2β, and 2γ) have been found; 2–12 exons are common to the three splice variants, and the first exon is specific for each variant. CRH binds to CRHR1 with high affinity. CRHR1 is mainly distributed in the anterior pituitary, and is involved in ACTH release. CRH also has high affinity to CRHR3. However, CRHR2 exhibits low affinity to CRH but high affinity to urotensin-I,sauvagine, and urocortins. CRHR2 is distributed in several restricted regions of the brain, but also in peripheral organs such as the heart, lung, muscle, and kidney. The CRH binding protein (CRH-BP, 37 kDa) has been highly conserved across evolution from crustaceans to humans. CRH-BP binds to CRH with high affinity and regulates CRH effects. In both mammals and nonmammalian vertebrates, pituitary and brain CRH-BP expression in the brain and pituitary are predominantly increased by stress. In the chicken, CRH2 is more potent in activating CRHR2 than CRHR1. In the medaka, Tcn and CRH have similar receptor interaction properties.

Signal transduction pathway

CRH activates AC via Gs protein-coupled with CRHRs. AC stimulates cAMP production, and cAMP, in turn, activates PKA, which phosphorylates downstream of cytosolic and nuclear targets such as CREB, resulting in induced gene transcription. Moreover, it is known that in addition to signaling pathways activated by cAMP, CRHR1 and CRHR2 trigger multiple signaling pathways such as the activation of p42/44 MAPK (ERK1/2).

Biological functions

CRH stimulates the synthesis and processing of proopiomelanocortin (POMC) to generate ACTH in the anterior pituitary. CRH also stimulates ACTH release. ACTH is secreted into the systemic circulation, reaches the adrenal cortex, and stimulates the synthesis and release of glucocorticoids. CRH also acts as a neuromodulator in the brain. CRH in the brain regulates the endocrine system, autonomic nervous system, and immune system in response to stress. In addition to the stress response, CRH is involved in multiple physiological functions such as suppression of food intake, regulation of body temperature, growth, metabolism, metamorphosis, reproduction, and diuresis. In mammals, CRH inhibits the female reproductive axis by suppressing gonadotropinreleasing hormone (GnRH) secretion. CRH2 stimulates TSHβ expression and shows a lower potency in inducing ACTH secretion in vitro in the chicken.

Synthesis and release

The synthesis and release of CRH are regulated by internal or external stress that is conveyed to the brain and is integrated at the hypothalamus, where CRH neurons exist. The synthesis and release of CRH are also regulated by diurnal rhythm and the negative feedback effect of cortisol. In nocturnal rats, CRH mRNA levels are higher at midday than at midnight. CRH is released from the axon terminal depending on Ca2+.

Description

CRH is a key activator of the hypothalamo-pituitaryadrenal (HPA) axis in response to internal or external stresses by stimulating adrenocorticotropic hormone (ACTH) secretion from the pituitary.

Biochem/physiol Actions

CRF is a hypothalamic peptide that releases ACTH and endorphin from the anterior pituitary. It is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.

Clinical Use

Clinical implications
Increased CRH production has been suggested to be associated with Alzheimer’s disease and depression. CRH deficiency has been observed to induce hypoglycemia and hepatitis. CRH has been used in the diagnosis of ACTH-dependent Cushing’s syndrome and Addison’s disease.
Use for diagnosis and treatment
CRHR1 antagonists Pexacerfont and Antalarmin are under clinical trial for the treatment of generalized anxiety disorder as well as depression and other mental disorders, respectively

Structure and conformation

CRH peptides of all species examined consist of 41 aa residues with an amidated C-terminus. The C-terminal region is important for physiological activity. The human, mouse, and rat CRH have identical aa sequences. CRH sequence homologies between human/mouse/rat and others are high (76%–95%). CRH2 peptides consist of 40–43 aa residues with an amidated C-terminus.
CRH peptides of all species

CRF (OVINE) Preparation Products And Raw materials

Raw materials

Preparation Products

CRF (OVINE) Suppliers

Global( 72)Suppliers
Supplier Tel Email Country ProdList Advantage
Career Henan Chemica Co
+86-0371-86658258 +86-13203830695 laboratory@coreychem.com China 30203 58
AFINE CHEMICALS LIMITED
+86-571-85134551 +86-18958018566 info@afinechem.com China 15058 58
BOC Sciences
16314854226; +8616314854226 inquiry@bocsci.com United States 19852 58
Hangzhou Go Top Peptide Biotech
0571-88211921 sales1@gotopbio.com CHINA 2609 58
Aladdin Scientific
tp@aladdinsci.com United States 50108 58
Moxin Chemicals
+86-17320513646 +86-17320513646 anna@molcoo.com China 9998 58
ANHUI BYERSEN BIOTECH CO. LTD
+86-15385096007 +86-17755058861 amy@byersenchemical.com China 10000 58
GL Biochem (Shanghai) Ltd 21-61263452 13641803416 ymbetter@glbiochem.com China 9981 64
Chengdu HuaXia Chemical Reagent Co. Ltd 400-1166-196 13458535857 cdhxsj@163.com China 13323 58
Wuxi Zhongkun Biochemical Technology Co., Ltd. 0510-85629785 18013409632; sales@reading-chemicals.com China 15165 58
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 OVINE corticotropin-releasinghormone corticotropin-releasinghormone))- Corticotropin Releasing Factor sheep, ≥95% (HPLC) CORTICOTROPIN RELEASING FACTOR SHEEP CORTICOTROPIN RELEASING FACTOR, OVINE CRF (OVINE) CRH CRF H-SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 CRF, CRH Acth releasing factor Acth releasing hormone Acth-releasing factor Acth-releasing hormone Corticoliberin Corticotropin releasing factor 41 Corticotropin releasing hormone 41 Corticotropin Releasing Factor, CRF, ovine CRF (hormone) Corticorelin Ovine (x = 4.1-8.2) 9015-71-8 C205H339N59O63S C205H339N59O63S1 Amino Acids and Peptides BioChemical Biochemicals and Reagents Peptides Releasing Factors Peptide