GRF (1-44) (human)
- CAS No.
- 83930-13-6
- Chemical Name:
- GRF (1-44) (human)
- Synonyms
- SOMATORELIN;GHRH (GH-Releasing Hormone);YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;HPGRF;GRF (HUMAN);HPGRF, HUMAN;GHRH (HUMAN);GRF Acetate;SOMATOLIBERIN;GHRF (1-44) HUMAN
- CBNumber:
- CB3311932
- Molecular Formula:
- C215H358N72O66S
- Molecular Weight:
- 5039.65082
- MDL Number:
- MFCD00081671
- MOL File:
- 83930-13-6.mol
- MSDS File:
- SDS
- TDS File:
- TDS
| storage temp. | −20°C |
|---|---|
| form | powder |
| color | White to off-white |
| Water Solubility | Water : 25 mg/mL (4.96 mM) |
| Sequence | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
| InChIKey | JAHCMOSSKRAPEL-IBFVROBCSA-N |
| EWG's Food Scores | 1 |
| FDA UNII | 4UR7N9Z9MM |
| ATC code | V04CD05 |
GRF (1-44) (human) price More Price(17)
| Manufacturer | Product number | Product description | CAS number | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|---|
| Usbiological | 547290 | Growth Hormone Releasing Hormone PurifiedbyProteinA/Gaffinitychromatography. | 200ul | $545 | 2026-06-03 | Buy | |
| Usbiological | 547289 | Growth Hormone Releasing Hormone PurifiedbyProteinA/Gaffinitychromatography. | 200ul | $555 | 2026-06-03 | Buy | |
| Biosynth | PGR-4127-V | GRF (Human) | 83930-13-6 | 0.5mg | $1733.92 | 2026-06-04 | Buy |
| Biosynth | PGR-4127-S | GRF (Human) | 83930-13-6 | 0.1mg | $515.15 | 2026-06-04 | Buy |
| Biosynth | FG109065 | GRF (human) acetate salt | 83930-13-6 | 1mg | $827.56 | 2026-06-04 | Buy |
GRF (1-44) (human) Chemical Properties,Uses,Production
Structure
GHRH(1–29) is the bioactive core of human GHRH. The N-terminal tyrosine residue with selected aromatic rings is important for the high bioactivity in human and nonrodent mammalian GHRH. The amino acid sequence of GHRH shows higher identities between the human, porcine, bovine, and caprine species, but the rat and mouse are exceptions. The sequence of the C-terminus is highly variable among species while the N-terminus is more conserved. The N-terminal region (1–27) of GHRH is well conserved in nonmammalian vertebrates. Zebrafish GHRH (1–27) shows 74.1%, 81.5%, and 81.5% similarity to the Xenopus tropicalis, chicken, and human counterparts, respectively. Mr 12,447 (GHRH(1-44), Mr 5,039), pI 10.3 (GHRH(1- 44), pI 11.5). Soluble in acidic aqueous solution (e.g., 1% acetic acid). Lyophilized GHRH is stable at room temperature for 2months, and recommended storage is below -18°C with desiccation.
Gene, mRNA, and precursor
The human GHRH gene, GHRH, location 20q11.2, consists of five exons. GHRH mRNA has 459 bases that encode a signal peptide of 24 aa residues, a mature protein of 44 aa residues, and a C-peptide of 31 aa residues with unknown function. In nonmammalian vertebrates, the GHRH-like peptide and PACAP were first believed to be encoded by the same gene, but later actual GHRH and PACAP were found to be encoded by two distinct genes.
Synthesis and release
The human GHRH gene, GHRH, location 20q11.2, consists of five exons. GHRH mRNA has 459 bases that encode a signal peptide of 24 aa residues, a mature protein of 44 aa residues, and a C-peptide of 31 aa residues with unknown function. In nonmammalian vertebrates, the GHRH-like peptide and PACAP were first believed to be encoded by the same gene, but later actual GHRH and PACAP were found to be encoded by two distinct genes.
Synthesis and release
The synthesis and release of GHRH are regulated by sex hormones, aging, the negative feedback effect of GH, and diverse pathological conditions. Gsh-1 has been considered a transcriptional factor of Ghrh expression in the rat hypothalamus. GHRH synthesis is inhibited by somatostatin (SS). The expression levels of the SS receptor, sst2A, in GHRH neurons are higher in female mice than male mice. The production of hypothalamic GHRH is decreased by aging. It is also negatively regulated by the feedback of GH, whereas ghrelin stimulates GHRH release.
Receptors
GHRH-R belongs to the GPCR B II subclass, highly selective for GHRH. The GHRH-R of most mammals consists of 423 aa residues. The N-terminal extracellular domain contains a site for N-glycosylation as well as six cysteine residues and an aspartate residue that are conserved in this receptor family. The third intracellular loop and the C-terminal intracellular domain contain several potential phosphorylation sites, which may regulate signaling and receptor internalization. It is mainly expressed in the pituitary.
Agonists and Antagonists
Tesamorelin, sermorelin (GHRH(1–29)-NH2), and CJC-1295 are agonists. Antagonists comprise the antibodies or peptides to GHRH-R: JV-1-10, JV-1-36, JV-1-37, JV-1-38, JV-1-39, JV-1-40, JV-1-41, JV-1-42, JV-1-43, JV-1-62, JV-1-63, MZ-4-71, MZ-4-169, MZ-4-181, MZ-4-243, MZ-5-78, MZ-5-156, MZ-5-192, MZ-6-55, [Ac-Tyr1, D-Arg2] GHRH(1–29)-NH2.
Biological functions
GHRH receptor mRNA is expressed in several organs, especially in the adrenal, digestive tract, and kidney. The primary function of GHRH is to stimulate GH synthesis and release from the anterior pituitary somatotrophs. GHRH activates cell proliferation, cell differentiation, and growth of somatotrophs, and is also involved in the modulation of appetite and feeding behavior, the regulation of sleeping, the control of jejunal motility, and the increase in leptin levels in modest obesity .
Clinical implications
Mutations in the GHRH gene have never been described. A single base change in the GHRH-R gene in human somatotropinoma confers hypersensitivity to GHRH binding. Pit-1 mutation inducing the low gene expression of GHRH-R can lead to the development of dwarfism.
Description
GHRH is expressed and secreted from the hypothalamic neurons of the arcuate nucleus (ARC). GHRH stimulates the release of growth hormone (GH) in the anterior pituitary. In 1982, three isoforms of GHRH(1–37, 1–40, 1–44 aa residues) were initially isolated from human pancreatic tumors that caused acromegaly, and the latter two were found in the human hypothalamus. The aa sequence of GHRH was also identified in various vertebrates from rodents to fish, including a protochordate. In nonmammalian vertebrates, GHRH-like peptide (pituitary adenylate cyclase-activating polypeptide (PACAP)-related peptide in mammals) was first isolated like GHRH, although the GHRH-like peptide had less activity on GH release. Later, actual GHRH, which was more phylogenetically and structurally similar to mammalian GHRH and showed GH-releasing activity, was isolated in nonmammalian vertebrates.
Uses
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary[1].
Clinical Use
Sermorelin, a functional peptide fragment of GHRH (1–29), has been used in the diagnosis and treatment of children with idiopathic growth hormone deficiency. Tesamorelin, a stabilized synthetic peptide analog of GHRH(1–44), received US Food and Drug Administration approval in 2010 for the treatment of lipodystrophy in HIV patients under highly active antiretroviral therapy, and was investigated for effects on certain cognitive functions in adults with cognitive impairment as well as healthy older adults.
Description
Growth Hormone Releasing Hormone Human Synthetic is a single, non-glycosylated, polypeptide chain containing 29 amino acids and having a molecular mass of 3358.9 Dalton.
Corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone consisting of 44 amino acid residues.
The GHRH is purified by proprietary chromatographic techniques.
Background
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acidpeptide hormoneproduced in the arcuate nucleusof the hypothalamus.
GHRH is released from neurosecretory nerve terminals of these arcuate neurons, and is carried by the hypothalamo-hypophysial portal circulation to the anterior pituitary glandwhere it stimulates growth hormone(GH) secretion. GHRH also stimulates the production of GH. GHRH is released in a pulsatile manner, stimulating similar pulsatile release of GH. In addition, GHRH also promotes slow-wave sleepdirectly.
References
[1] Fridlyand LE, et al.Growth Hormone-Releasing Hormone in Diabetes.Front Endocrinol (Lausanne). 2016 Oct 10;7:129. eCollection 2016. DOI:10.3389/fendo.2016.00129
GRF (1-44) (human) Preparation Products And Raw materials
Raw materials
Preparation Products
GRF (1-44) (human) Suppliers
| Supplier | Tel | Country | ProdList | Advantage | |
|---|---|---|---|---|---|
| J & K SCIENTIFIC LTD. | 18210857532 18210857532 | jkinfo@jkchemical.com | China | 96815 | 76 |
| Shanghai Hanhong Scientific Co.,Ltd. | 021-54306202 13764082696 | info@hanhongsci.com | China | 42917 | 64 |
| Chemsky（shanghai）International Co.,Ltd. | 021-50135380 | shchemsky@sina.com | China | 32273 | 50 |
| Lavem Chine Pharm Company | 028-62070218 18190869852 | sales@lavemc.com | China | 214 | 67 |
| Cellmano Biotech Limited | 0551-65326643 18156095617 | info@cellmano.com | China | 1010 | 55 |
| Beijing HuaMeiHuLiBiological Chemical | 010-56205725 | waley188@sohu.com | China | 12323 | 58 |
| Shanghai Aladdin Bio-Chem Technology Co.,LTD | 400-6206333 13167063860 | anhua.mao@aladdin-e.com | China | 29985 | 65 |
| MedChemexpress LLC | 021-58955995 | sales@medchemexpress.cn | United States | 4853 | 58 |
| Chengdu HuaXia Chemical Reagent Co. Ltd | 400-1166-196 13458535857 | cdhxsj@163.com | China | 13323 | 58 |
| Wuxi Zhongkun Biochemical Technology Co., Ltd. | 0510-85629785 18013409632; | sales@reading-chemicals.com | China | 15165 | 58 |
View Lastest Price from GRF (1-44) (human) manufacturers
| Image | Update time | Product | Price | Min. Order | Purity | Supply Ability | Manufacturer | |
|---|---|---|---|---|---|---|---|---|
 |
2025-12-25 | Somatorelin GRF(human)Acetate
83930-13-6
|
1gram | 99% | 10kg | Zhejiang J&C Biological Technology Co.,Limited | ||
 |
2021-07-13 | GRF (human)
83930-13-6
|
$10.00-15.00 | 1KG | 99%+ HPLC | Zhuozhou Wenxi import and Export Co., Ltd | ||
 |
2021-07-09 | GRF (human)
83930-13-6
|
$10.00-15.00 | 1KG | 99%+ HPLC | Zhuozhou Wenxi import and Export Co., Ltd |
-
- Somatorelin GRF(human)Acetate
83930-13-6
- $0.00
- 99%
- Zhejiang J&C Biological Technology Co.,Limited
-
- GRF (human)
83930-13-6
- $10.00-15.00
- 99%+ HPLC
- Zhuozhou Wenxi import and Export Co., Ltd
-
- GRF (human)
83930-13-6
- $10.00-15.00
- 99%+ HPLC
- Zhuozhou Wenxi import and Export Co., Ltd
