ENFUVIRTIDE

74038-65-6 Basic information More..

Product Name:	ENFUVIRTIDE
Synonyms:	AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-AMIDE;AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2;AC-TYR-THR-SER-LEU-ILE-HIS-SER-LEU-ILE-GLU-GLU-SER-GLN-ASN-GLN-GLN-GLU-LYS-ASN-GLU-GLN-GLU-LEU-LEU-GLU-LEU-ASP-LYS-TRP-ALA-SER-LEU-TRP-ASN-TRP-PHE-NH2;ENFUVIRTIDE (T-20);ENVELOPE GLYCOPROTEIN FRAGMENT ACETYL/AMIDE[HUMAN IMMUNODEFICIENCY VIRUS 1];CH3CO-TYR-THR-SER-LEU-ILE-HIS-SER-LEU-ILE-GLU-GLU-SER-GLN-ASN-GLN-GLN-GLU-LYS-ASN-GLU-GLN-GLU-LEU-LEU-GLU-LEU-ASP-LYS-TRP-ALA-SER-LEU-TRP-ASN-TRP-PHE-NH2;5-Cyclohexyl-5-(tetrahydrothiophen-3-yl)hydantoin;2,4-Imidazolidinedione, 5-cyclohexyl-5-(tetrahydro-3-thienyl)-
CAS:	74038-65-6
MF:	C13H20N2O2S
MW:	268.38
EINECS:
Mol File:	74038-65-6.mol

Information Error Report

Your Email:

Browse by province 74038-65-6 Suppliers

74038-65-6 Recommend Suppliers

Recommend You Select Member Companies

Company Name:	GL Biochem (Shanghai) Ltd Recommend Complaint

Tel:	21-61263452 13641803416
Email:	ymbetter@glbiochem.com
Products Intro:	Product Name:T20;Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 CAS:74038-65-6 Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
CB Index:	64
WebSite:	http://www.glschina.com/
Related Information:	Sales Network Catalog(9981) User Evaluation(7)

Company Name:	Beijing HuaMeiHuLiBiological Chemical Recommend Complaint

Tel:	010-56205725
Email:	waley188@sohu.com
Products Intro:	CAS:74038-65-6 Purity:99% Package:500g More...
CB Index:	58
WebSite:	www.huabeibiochem.com
Related Information:	Sales Network Catalog(12323) User Evaluation(19)

Company Name:	Nanjing Peptide Biotech Ltd. Recommend Complaint

Tel:	025-58361106-805 15951641583
Email:	zhao.xu@njpeptide.com
Products Intro:	Product Name:T20;Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 CAS:74038-65-6 Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
CB Index:	55
WebSite:	http://www.njpeptide.com
Related Information:	Sales Network Catalog(9976) User Evaluation

Company Name:	JinJin Le Chemical Co., Ltd Recommend Complaint

Tel:	18001959627(微信同号) 18001959627
Email:	jjlchem2@163.com
Products Intro:	Product Name:T-20 Purity:On Request Package:电询
CB Index:	58
WebSite:	http://www.jinjinlechem.com
Related Information:	Sales Network Catalog(9890) User Evaluation(1)

Company Name:	Shanghai Chain peptide Biological Co., Ltd. Recommend Complaint

Tel:	+86 18516118859
Email:	sales@chainpeptide.com
Products Intro:	Product Name:Enfuvirtide CAS:74038-65-6 Purity:95% Package:5g;10g;100g;1kgs;10kgs More...
CB Index:	58
WebSite:	www.chainpeptide.com
Related Information:	Sales Network Catalog(419) User Evaluation

Company Name:	Dideu Industries Group Limited Recommend Complaint

Tel:	+8617392712697
Email:	1022@dideu.com
Products Intro:	Product Name:ENFUVIRTIDE CAS:74038-65-6 Purity:99.9% Package:25kgs/Drum;200kgs/Drum Remarks:FDA GMP CEP Approved Manufacturer
CB Index:	58
WebSite:	www.dideu.com
Related Information:	Sales Network Catalog(29090) User Evaluation

Company Name:	Ontores Biotech Recommend Complaint

Tel:	0571-88760729 18072970094
Email:	supports@ontorespeptide.com
Products Intro:	Product Name:Enfuvirtide (T-20) Purity:98% HPLC Package:5mg;100mg;1g;5g;1kg
CB Index:	58
WebSite:	www.ontoresinc.cn
Related Information:	Sales Network Catalog(2696) User Evaluation

Company Name:	Nanjing Shizhou Biology Technology Co.,Ltd Recommend Complaint

Tel:	13675144456
Email:	alan.chow@synzest.com
Products Intro:	Product Name:Enfuvirtide(T-20) Purity:95% HPLC Package:100mg;250mg;500mg;1g;5g Remarks:apnoke
CB Index:	58
WebSite:	www.synzest.com
Related Information:	Sales Network Catalog(9467) User Evaluation

1 2 3 4 5

Tag: 74038-65-6

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

Login