404882-00-4 Basic information More..
Product Name:Obtustatin
Synonyms:CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36);Obtustatin
CAS:404882-00-4
MF:
MW:0
EINECS:
Mol File:Mol File
404882-00-4
Information Error Report
Your Email:
404882-00-4 Recommend Suppliers
Recommend You Select Member Companies...
Company Name: Shanghai Longyu Biotechnology Co., Ltd.      Recommend     Complaint
Tel:
FAX: +86 15821988213
Email: info@longyupharma.com
Nationality: China
Products Intro: Product Name:Obtustatin
Purity:0.99 Package:100gram;1kilo;5kilo;466kilo Remarks:Accept Paypal/western union/bitcoin/money gram/alibaba trade assurance
CB Index: 58
WebSite: www.chemicalbook.com/manufacturer/shanghai-longyu-biotechnology-164/
Related Information: Sales Network   Catalog(2556)   User Evaluation
Company Name: Changsha MOL Changes Biotechnology Co., Ltd.      Recommend     Complaint
Tel:
FAX:
Email: info@molchanges.com
Nationality: China
Products Intro: Product Name:Obtustatin
Purity:99% Package:5mg;10mg;100mg;1g;10g;100g
CB Index: 58
WebSite: www.molchanges.com
Related Information: Sales Network   Catalog(5221)   User Evaluation
Company Name: Wuxi Zhongkun Biochemical Technology Co., Ltd.      Recommend    Complaint
Tel: 0510-85629785
FAX: 051085625359
Email: sales@reading-chemicals.com
Products Intro: Product Name:Obtustatin
Purity:95%+ Package:根据客户需求包装   More...
CB Index: 58
WebSite: www.reading-chemicals.com
Related Information: Sales Network   Catalog(15178)   User Evaluation(1)
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.      Recommend    Complaint
Tel: 0571-87213919
FAX: 0571-87213919
Email: Eric@peptidego.com
Products Intro: Product Name:Obtustatin
Purity:95% Package:0.1mg,1mg;5mg;10mg;50mg;100mg or according to customer's detail requirement.   More...
CB Index: 58
WebSite: http://www.peptidego.com
Related Information: Sales Network   Catalog(7061)   User Evaluation
Company Name: Wuxi Helen Biotechnology Co., Ltd.,      Recommend    Complaint
Tel: 0510-85629785
FAX: 0510-85625359
Email: sales@reading-chemicals.com
Products Intro: Product Name:Obtustatin
Purity:>=95% Package:10mg;25mg;50mg;100mg;200mg;500mg   More...
CB Index: 58
WebSite: http://www.reading-chemicals.com
Related Information: Sales Network   Catalog(14081)   User Evaluation
Company Name: Nanjing Yuanpeptide Biotech Co.,Ltd.      Recommend    Complaint
Tel:
FAX:
Email: support@yuan-peptide.com
Products Intro: Product Name:Obtustatin
Purity:95% HPLC 98% HPLC 99% HPLC Package:10mg;20mg;50mg;100mg;1g;5g;20g   More...
CB Index: 58
WebSite: http://www.yuan-peptide.com
Related Information: Sales Network   Catalog(2983)   User Evaluation
Company Name: Shaoxing Junyu Biotechnology Co., LTD      Recommend    Complaint
Tel: 0571-88211921
FAX:
Email: 1092698600@qq.com
Products Intro: Product Name:Obtustatin
Purity:99% HPLC MS Package:1mg;5mg;10mg;100mg;500mg;1kg;5kg;25kg   More...
CB Index: 58
WebSite: http://www.gotopbio.com/
Related Information: Sales Network   Catalog(5146)   User Evaluation(2)
Company Name: Hangzhou Sinoda Pharmaceutical Technology Co. LTD      Recommend    Complaint
Tel: 0571-87213919
FAX:
Email: 3007955328@qq.com
Products Intro: Product Name:Obtustatin
Purity:0.95 Package:0.1mg,1mg;5mg;10mg;50mg;100mg or according to customer's detail requirement.   More...
CB Index: 58
WebSite: www.chemicalbook.com/showsupplierproductslist1355681/0.htm
Related Information: Sales Network   Catalog(6628)   User Evaluation
1 2 3
Tag: 404882-00-4
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.