138398-61-5 Basic information More..
Product Name:AMYLIN (8-37) (RAT)
Synonyms:AMYLIN (8-37) (RAT);Amylin (8-37) (mouse, rat);Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2;ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2;H-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2;diabetes associated peptide amide*fragment 8-37 R;LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2DISULFIDE BRIDGE CYS2-CYS7;Amylin (8-37) (mouse, rat) H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
CAS:138398-61-5
MF:C140H227N43O43
MW:3200.61
EINECS:
Mol File:138398-61-5.mol
138398-61-5

AMYLIN (8-37) (RAT) manufacturers

  • Amylin (8-37),rat
  • US $0.10-0.30 / kg
  • 2025-06-03
  • CAS:138398-61-5
  • Min. Order: 1kg
  • Purity: ≥98.0%
  • Supply Ability: 20 tons
  • AMYLIN (8-37) (RAT)
  • US $7.00 / KG
  • 2020-02-14
  • CAS: 138398-61-5
  • Min. Order: 1KG
  • Purity: 99%
  • Supply Ability: 100kg
Information Error Report
Your Email:
138398-61-5 Recommend Suppliers
Recommend You Select Member Companies...
Company Name: Zibo Hangyu Biotechnology Development Co., Ltd      Recommend     Complaint
Tel: +86-0533-2185556
FAX:
Email: nickzhang@hangyubiotech.com
Nationality: China
Products Intro: Product Name:Amylin (8-37),rat
CAS:138398-61-5
Purity:>=98.0% Package:1kg;0.1USD|3kg;0.2USD|5kg;0.3USD
CB Index: 58
WebSite: www.chemicalbook.com/manufacturer/hangyu-chemical-25178/
Related Information: Sales Network   Catalog(10997)   User Evaluation
Company Name: Cellmano Biotech Limited      Recommend     Complaint
Tel: 0551-65326643
FAX: 0551-65326641
Email: info@cellmano.com
Nationality: China
Products Intro: Product Name:Amylin (8-37) (mouse, rat)
CAS:138398-61-5
CB Index: 58
WebSite: http://www.cellmano.com/
Related Information: Sales Network   Catalog(995)   User Evaluation
Company Name: career henan chemical co      Recommend     Complaint
Tel: +86-0371-86658258
FAX: 0086-371-86658258
Email: factory@coreychem.com
Nationality: China
Products Intro: Product Name:AMYLIN (8-37) (RAT)
CAS: 138398-61-5
Purity:99% Package:1KG;7USD
CB Index: 58
WebSite: www.coreychem.com
Related Information: Sales Network   Catalog(29800)   User Evaluation(1)
Company Name: Dideu Industries Group Limited      Recommend     Complaint
Tel: +86-29-89586680
FAX:
Email: 1026@dideu.com
Nationality: China
Products Intro: Product Name:AMYLIN (8-37) (RAT)
CAS:138398-61-5
Purity:99.9% Package:25kgs/Drum;200kgs/Drum Remarks:FDA GMP CEP Approved Manufacturer
CB Index: 58
WebSite: https://www.dideu.com
Related Information: Sales Network   Catalog(20601)   User Evaluation
Company Name: Zhejiang J&C Biological Technology Co.,Limited      Recommend     Complaint
Tel: +1-2135480471
FAX:
Email: sales@sarms4muscle.com
Nationality: China
Products Intro: CAS:138398-61-5
Purity:99% Package:5KG;1KG
CB Index: 58
WebSite: https://www.sarms4muscle.com
Related Information: Sales Network   Catalog(10473)   User Evaluation
Company Name: Hangzhou Go Top Peptide Biotech      Recommend     Complaint
Tel: 0571-88211921
FAX:
Email: sales1@gotopbio.com
Nationality: CHINA
Products Intro: Product Name:Amylin(8-37),rat
CAS:138398-61-5
Purity:98% HPLC、MS Package:1mg/ plastic bottle ,customer's requirement packaging also welcome
CB Index: 58
WebSite: http://www.gotopbio.com/
Related Information: Sales Network   Catalog(2609)   User Evaluation
Company Name: Moxin Chemicals      Recommend     Complaint
Tel: +86-17320513646
FAX:
Email: anna@molcoo.com
Nationality: China
Products Intro: Product Name:Amylin (8-37),rat
CAS:138398-61-5
Purity:99% HPLC Package:5mg;20mg; 50mg Remarks:We can also customize related analogues and modified peptides including HPLC, MS, 1H-NMR, MS, HPLC, IR, UV, COA, MSDS. This product is intended for laboratory use only!
CB Index: 58
WebSite: www.molcoo.com/
Related Information: Sales Network   Catalog(10000)   User Evaluation
Company Name: DAYANG CHEM (HANGZHOU) CO.,LTD      Recommend     Complaint
Tel: +86-88938639
FAX:
Email: info@dycnchem.com
Nationality: China
Products Intro: Product Name:Amylin (8-37) (mouse, rat)
CAS:138398-61-5
Purity:0.95&0.99 Package:0.1KG;1KG;1000KG Remarks:Wholesale price
CB Index: 58
WebSite: www.dycnchem.com
Related Information: Sales Network   Catalog(53900)   User Evaluation
1 2 3 4 5 6 7 8 9
Tag: 138398-61-5
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.