120796-97-6 Basic information More..
Product Name:Big ET-1 (1-38) (human)
Synonyms:BIG ENDOTHELIN-1 (1-38) (HUMAN);BIG ENDOTHELIN-1 (HUMAN);BIG-ENDOTHELIN-I (1-38), HUMAN;BIG ENDOTHELIN-1 (HUMAN, 1-38);BIG ENDOTHELIN 38 HUMAN;CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-ARG-SER;CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS;CSCSSLMDKECVYFCHLDIIWVNIPEHWPYGLGSPRS
CAS:120796-97-6
MF:C189H282N48O56S5
MW:4282.87
EINECS:
Mol File:Mol File
120796-97-6

Big ET-1 (1-38) (human) manufacturers

Information Error Report
Your Email:
120796-97-6 Recommend Suppliers
Recommend You Select Member Companies
Company Name: GL Biochem (Shanghai) Ltd      Recommend    Complaint
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:Big Endothelin-1 (1-38), human
CAS:120796-97-6
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g  More...
CB Index: 64
WebSite: http://www.glschina.com/
Related Information: Sales Network   Catalog(9981)   User Evaluation(7)
Company Name: Chemsky(shanghai)International Co.,Ltd.      Recommend    Complaint
Tel: 021-50135380
Email: shchemsky@sina.com
Products Intro: Product Name:Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser (Disulfide bridges Cys1-Cys15 and Cys3-Cys11);Big-Endothelin-I (1-38), huMan
CAS:120796-97-6
Purity:98%+  More...
CB Index: 50
WebSite: www.shchemsky.com
Related Information: Sales Network   Catalog(32273)   User Evaluation
Company Name: Wuxi Zhongkun Biochemical Technology Co., Ltd.      Recommend    Complaint
Tel: 0510-85629785 18013409632;
Email: sales@reading-chemicals.com
Products Intro: Product Name:Big Endothelin-1 (1-38), human
CAS:120796-97-6
Purity:95%+ Package:根据客户需求包装  
CB Index: 58
WebSite: www.reading-chemicals.com
Related Information: Sales Network   Catalog(15165)   User Evaluation(1)
Company Name: Nanjing Peptide Biotech Ltd.      Recommend    Complaint
Tel: 025-58361106-805 15951641583
Email: zhao.xu@njpeptide.com
Products Intro: Product Name:Big Endothelin-1 (1-38), human
CAS:120796-97-6
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC  More...
CB Index: 55
WebSite: http://www.njpeptide.com
Related Information: Sales Network   Catalog(9976)   User Evaluation
Company Name: Chengdu Youngshe Chemical Co., Ltd.      Recommend    Complaint
Tel: +86-17380623303
Email: Caroline@youngshechem.com
Products Intro: Product Name:Big Endothelin-1 (1-38), human
CAS:120796-97-6
Purity:95% Package:1G; 10G; 100G  
CB Index: 58
WebSite: https://shop326109856.taobao.com/
Related Information: Sales Network   Catalog(4725)   User Evaluation
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.      Recommend    Complaint
Tel: 0571-87213919 15967184799
Email: Eric@peptidego.com
Products Intro: CAS:120796-97-6
Purity:98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. Remarks:1g  
CB Index: 58
WebSite: peptidego.com
Related Information: Sales Network   Catalog(7872)   User Evaluation
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.      Recommend    Complaint
Tel: meitaochem@126.com
Email: meitaochem@126.com
Products Intro: Product Name:Big Endothelin-1 (1-38), human
CAS:120796-97-6
Purity:99% HPLC Package:500g;1kg;5kg;25kg  
CB Index: 58
WebSite: www.chemicalbook.com/ShowSupplierProductsList31244/0_EN.htm
Related Information: Sales Network   Catalog(19087)   User Evaluation
Company Name: Zhejiang J&C Biological Technology Co.,Limited      Recommend    Complaint
Tel: +1-2135480471
Email: sales@sarms4muscle.com
Products Intro: CAS:120796-97-6
Purity:99% Package:5KG;1KG  
CB Index: 58
WebSite: https://www.sarms4muscle.com
Related Information: Sales Network   Catalog(10378)   User Evaluation
1 2 3 4 5 6
Tag: 120796-97-6
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.