86472-71-1 Basic information More..
Product Name:GRF (1-43) (rat)
Synonyms:somatotropin releasing hormone (1-43);somatoliberin, rat;HIS-ALA-ASP-ALA-ILE-PHE-THR-SER-SER-TYR-ARG-ARG-ILE-LEU-GLY-GLN-LEU-TYR-ALA-ARG-LYS-LEU-LEU-HIS-GLU-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-ARG-SER-ARG-PHE-ASN;GRF (rat) SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat);SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat);Growth HorMone Releasing Factor ratGrowth HorMone Releasing;GHRF RAT;HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN
CAS:86472-71-1
MF:C225H360N76O67S
MW:5233.7999
EINECS:
Mol File:86472-71-1.mol
86472-71-1
Information Error Report
Your Email:
86472-71-1 Recommend Suppliers
Recommend You Select Member Companies
Company Name: GL Biochem (Shanghai) Ltd      Recommend    Complaint
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:GHRF, rat
CAS:86472-71-1
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g  More...
CB Index: 64
WebSite: http://www.glschina.com/
Related Information: Sales Network   Catalog(9981)   User Evaluation(7)
Company Name: Shanghai Hanhong Scientific Co.,Ltd.      Recommend    Complaint
Tel: 021-54306202 13764082696
Email: info@hanhongsci.com
Products Intro: Product Name:GRF (rat)
CAS:86472-71-1
Remarks:157P15  More...
CB Index: 64
WebSite: https://www.hanhongsci.com
Related Information: Sales Network   Catalog(42917)   User Evaluation(28)
Company Name: Chemsky (shanghai) International Co.,Ltd      Recommend    Complaint
Tel: 021-50135380
Email: shchemsky@sina.com
Products Intro: Product Name:GRF (rat);H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn-OH;SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat)
CAS:86472-71-1
Purity:99% Package:0.5Mg  More...
CB Index: 60
WebSite: www.shchemsky.com
Related Information: Sales Network   Catalog(15350)   User Evaluation(2)
Company Name: Cellmano Biotech Limited      Recommend    Complaint
Tel: 0551-65326643 18156095617
Email: info@cellmano.com
Products Intro: Product Name:GRF (rat) SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat)
CAS:86472-71-1
Purity:98% HPLC Package:5Mg;10Mg;1g  More...
CB Index: 55
WebSite: https://www.cellmano.com
Related Information: Sales Network   Catalog(1010)   User Evaluation
Company Name: Wuxi Zhongkun Biochemical Technology Co., Ltd.      Recommend    Complaint
Tel: 0510-85629785 18013409632;
Email: sales@reading-chemicals.com
Products Intro: Product Name:GHRF (Rat)
CAS:86472-71-1
Purity:95%+ Package:根据客户需求包装  
CB Index: 58
WebSite: www.reading-chemicals.com
Related Information: Sales Network   Catalog(15165)   User Evaluation(1)
Company Name: Nanjing Leon Biological Technology Co., Ltd.      Recommend    Complaint
Tel: 025-84523390 -127; 17705183659
Email: sales@njleonbiotech.com
Products Intro: Product Name:GHRF (Rat)
CAS:86472-71-1
Purity:98% HPLC Package:5mg;1G;10G;100G;1KG  More...
CB Index: 55
WebSite: http://www.njleonbiotech.com
Related Information: Sales Network   Catalog(5501)   User Evaluation
Company Name: Nanjing Peptide Biotech Ltd.      Recommend    Complaint
Tel: 025-58361106-805 15951641583
Email: zhao.xu@njpeptide.com
Products Intro: Product Name:GHRF (Rat)
CAS:86472-71-1
Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g  More...
CB Index: 55
WebSite: http://www.njpeptide.com
Related Information: Sales Network   Catalog(9976)   User Evaluation
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.      Recommend    Complaint
Tel: 0571-87213919 15967184799
Email: Eric@peptidego.com
Products Intro: Product Name:GHRF (Rat)
CAS:86472-71-1
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.  
CB Index: 58
WebSite: peptidego.com
Related Information: Sales Network   Catalog(7872)   User Evaluation
1 2 3 4 5 6 7
Tag: 86472-71-1
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.