CECROPIN B

80451-05-4 Basic information More..

Product Name:	CECROPIN B
Synonyms:	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;CECROPIN B;LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Aids096161;Aids-096161;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);Cecropin B, ≥97% (HPLC)
CAS:	80451-05-4
MF:	C176H302N52O41S
MW:	3834.66988
EINECS:
Mol File:	80451-05-4.mol

CECROPIN B manufacturers

Information Error Report

Your Email:

Browse by province 80451-05-4 Suppliers

80451-05-4 Recommend Suppliers

Recommend You Select Member Companies...

Company Name:	Zibo Hangyu Biotechnology Development Co., Ltd Recommend Complaint

Tel:	+86-0533-2185556
FAX:
Email:	nickzhang@hangyubiotech.com
Nationality:	China
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:>98% Package:1kg;0.1USD\|3kg;0.2USD\|5kg;0.3USD
CB Index:	58
WebSite:	www.chemicalbook.com/manufacturer/hangyu-chemical-25178/
Related Information:	Sales Network Catalog(11000) User Evaluation

Company Name:	Cellmano Biotech Limited Recommend Complaint

Tel:	0551-65326643
FAX:	0551-65326641
Email:	info@cellmano.com
Nationality:	China
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:98.0% min
CB Index:	58
WebSite:	http://www.cellmano.com/
Related Information:	Sales Network Catalog(995) User Evaluation

Company Name:	Career Henan Chemica Co Recommend Complaint

Tel:	+86-0371-86658258
FAX:	0371-86658258
Email:	laboratory@coreychem.com
Nationality:	China
Products Intro:	Product Name:CECROPIN B CAS:80451-05-4 Purity:99% Package:1g;7USD
CB Index:	58
WebSite:	www.coreychem.com/
Related Information:	Sales Network Catalog(30230) User Evaluation

Company Name:	Wuhan Fortuna Chemical Co., Ltd Recommend Complaint

Tel:	+86-027-59207850
FAX:	86-27-59524646
Email:	info@fortunachem.com
Nationality:	China
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:95% Package:1mg;USD\|10mg;USD
CB Index:	58
WebSite:	http://www.fortunachem.com/
Related Information:	Sales Network Catalog(5950) User Evaluation

Company Name:	Zhejiang J&C Biological Technology Co.,Limited Recommend Complaint

Tel:	+1-2135480471
FAX:
Email:	sales@sarms4muscle.com
Nationality:	China
Products Intro:	CAS:80451-05-4 Purity:99% Package:5KG;1KG
CB Index:	58
WebSite:	https://www.sarms4muscle.com
Related Information:	Sales Network Catalog(10473) User Evaluation

Company Name:	Hangzhou Go Top Peptide Biotech Recommend Complaint

Tel:	0571-88211921
FAX:
Email:	sales1@gotopbio.com
Nationality:	CHINA
Products Intro:	Product Name:CecropinB CAS:80451-05-4 Purity:98% HPLC、MS Package:1mg/ plastic bottle ,customer's requirement packaging also welcome
CB Index:	58
WebSite:	http://www.gotopbio.com/
Related Information:	Sales Network Catalog(2609) User Evaluation

Company Name:	Moxin Chemicals Recommend Complaint

Tel:
FAX:
Email:	Anna@molcoo.com
Nationality:	China
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:99% HPLC Package:5mg;20mg; 50mg Remarks:We can also customize related analogues and modified peptides including HPLC, MS, 1H-NMR, MS, HPLC, IR, UV, COA, MSDS. This product is intended for laboratory use only!
CB Index:	58
WebSite:	www.molcoo.com/
Related Information:	Sales Network Catalog(9902) User Evaluation

Company Name:	Hybio Pharmaceutical Co., Ltd. Recommend Complaint

Tel:	+86-18964595316
FAX:	027-65026759
Email:	sales1@hybio.com.cn
Nationality:	China
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:0.99 Package:5KG;1KG
CB Index:	58
WebSite:	www.hybio.com.cn/
Related Information:	Sales Network Catalog(361) User Evaluation

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16

Tag: 80451-05-4

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.