CECROPIN B

80451-05-4 Basic information More..

Product Name:	CECROPIN B
Synonyms:	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;CECROPIN B;LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Aids096161;Aids-096161;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);Cecropin B, ≥97% (HPLC)
CAS:	80451-05-4
MF:	C176H302N52O41S
MW:	3834.66988
EINECS:
Mol File:	80451-05-4.mol

CECROPIN B manufacturers

Information Error Report

Your Email:

Browse by province 80451-05-4 Suppliers

80451-05-4 Recommend Suppliers

Recommend You Select Member Companies

Company Name:	GL Biochem (Shanghai) Ltd Recommend Complaint

Tel:	21-61263452 13641803416
Email:	ymbetter@glbiochem.com
Products Intro:	Product Name:Cecropin B;KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 CAS:80451-05-4 Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
CB Index:	64
WebSite:	http://www.glschina.com/
Related Information:	Sales Network Catalog(9981) User Evaluation(7)

Company Name:	Shanghai Hanhong Scientific Co.,Ltd. Recommend Complaint

Tel:	021-54306202 13764082696
Email:	info@hanhongsci.com
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Remarks:81P04 More...
CB Index:	64
WebSite:	https://www.hanhongsci.com
Related Information:	Sales Network Catalog(42917) User Evaluation(28)

Company Name:	Chemsky (shanghai) International Co.,Ltd Recommend Complaint

Tel:	021-50135380
Email:	shchemsky@sina.com
Products Intro:	Product Name:Cecropin B;H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2; CAS:80451-05-4 Purity:99% Package:1.0Mg More...
CB Index:	60
WebSite:	www.shchemsky.com
Related Information:	Sales Network Catalog(15350) User Evaluation(2)

Company Name:	Dalian Meilun Biotech Co., Ltd. Recommend Complaint

Tel:	0411-62910999 13889544652
Email:	sales@meilune.com
Products Intro:	Product Name:CecropinB CAS:80451-05-4 Purity:>95%,BR Package:5mg/1200 Remarks:MB10951-1
CB Index:	58
WebSite:	http://www.meilunbio.com/
Related Information:	Sales Network Catalog(4765) User Evaluation(3)

Company Name:	Haoyuan Chemexpress Co., Ltd. Recommend Complaint

Tel:	021-58950125
Email:	info@chemexpress.com
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:>98% Package:900RMB/500ug More...
CB Index:	61
WebSite:	http://www.chemexpress.com.cn
Related Information:	Sales Network Catalog(7545) User Evaluation(12)

Company Name:	Guangzhou Isun Pharmaceutical Co., Ltd Recommend Complaint

Tel:	020-39119399 18927568969
Email:	isunpharm@qq.com
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:>=98.0% Package:25Mg; 1g; 100g; 500g More...
CB Index:	55
WebSite:	http://www.isunpharm.com
Related Information:	Sales Network Catalog(4773) User Evaluation(5)

Company Name:	Bide Pharmatech Ltd. Recommend Complaint

Tel:	400-164-7117 18317119277
Email:	product02@bidepharm.com
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:99% Package:1mg;5mg;10mg;25mg;50mg Remarks:BD120227
CB Index:	60
WebSite:	www.bidepharm.com
Related Information:	Sales Network Catalog(40000) User Evaluation(30)

Company Name:	Wuxi Zhongkun Biochemical Technology Co., Ltd. Recommend Complaint

Tel:	0510-85629785 18013409632;
Email:	sales@reading-chemicals.com
Products Intro:	Product Name:Cecropin B CAS:80451-05-4 Purity:95%+ Package:根据客户需求包装
CB Index:	58
WebSite:	www.reading-chemicals.com
Related Information:	Sales Network Catalog(15165) User Evaluation(1)

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16

Tag: 80451-05-4

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.