1802086-25-4(GIP (3 - 42), human)

1802086-25-4 Basic information More..

Product Name:	GIP (3 - 42), human
Synonyms:	GIP (3 - 42), human;GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN;EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH;GIP (3-42), human - 1 mg;Gastric Inhibitory Polypeptide (3-42) (human)、GIP(
CAS:	1802086-25-4
MF:
MW:	0
EINECS:
Mol File:	Mol File

Information Error Report

Your Email:

Browse by Nationality 1802086-25-4 Suppliers

United States(4)

Member(4)

All(4)

1802086-25-4 Recommend Suppliers

Recommend You Select Member Companies.

Company Name:	BOC Sciences Recommend Complaint
Tel:	1-631-485-4226; 16314854226
Email:	info@bocsci.com
Nationality:	United States
Products Intro:	Product Name:Gastric Inhibitory Polypeptide (3-42) (human) CAS:1802086-25-4 Purity:>=95% Remarks:Reach out to us for more information about custom solutions.
CB Index:	65
WebSite:	https://www.bocsci.com
Related Information:	Sales Network Catalog(12952) User Evaluation(16)

Company Name:	TargetMol Chemicals Inc. Recommend Complaint
Tel:	+1-781-999-5354; +17819995354
Email:	marketing@targetmol.com
Nationality:	United States
Products Intro:	Product Name:GIP (3-42), human CAS:1802086-25-4 Package:1mg;196USD\|5mg;487USD\|10mg;696USD
CB Index:	58
WebSite:	https://www.targetmol.com/
Related Information:	Sales Network Catalog(32467) User Evaluation

Company Name:	Aladdin Scientific Recommend Complaint
Tel:
Email:	tp@aladdinsci.com
Nationality:	United States
Products Intro:	Product Name:GIP (3-42), human CAS:1802086-25-4 Purity:98% Package:$250.9/1mg;$750.9/5mg;$1200.9/10mg;Bulk package Remarks:98%
CB Index:	58
WebSite:	www.aladdinsci.com/
Related Information:	Sales Network Catalog(52923) User Evaluation

Company Name:	MedChemExpress Recommend Complaint
Tel:	021-58955995
Email:	sales@medchemexpress.com
Nationality:	United States
Products Intro:	Product Name:GIP (3-42), human CAS:1802086-25-4
CB Index:	58
WebSite:	www.medchemexpress.com
Related Information:	Sales Network Catalog(6398) User Evaluation

Tag: 1802086-25-4

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.