1802086-25-4(GIP (3 - 42), human)

1802086-25-4 Basic information More..
Product Name:GIP (3 - 42), human
Synonyms:GIP (3 - 42), human;GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN;EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH;GIP (3-42), human - 1 mg;Gastric Inhibitory Polypeptide (3-42) (human)、GIP(
CAS:1802086-25-4
MF:
MW:0
EINECS:
Mol File:Mol File
1802086-25-4
Information Error Report
Your Email:
Browse by Nationality 1802086-25-4 Suppliers China suppliers
United States(4) Member(4) All(4)
1802086-25-4 Recommend Suppliers
Recommend You Select Member Companies.
Company Name: BOC Sciences    Recommend    Complaint
Tel: 1-631-485-4226; 16314854226
Email: info@bocsci.com
Nationality: United States
Products Intro: Product Name:Gastric Inhibitory Polypeptide (3-42) (human)
CAS:1802086-25-4
Purity:>=95% Remarks:Reach out to us for more information about custom solutions.
CB Index: 65
WebSite: https://www.bocsci.com
Related Information: Sales Network   Catalog(12952)   User Evaluation(16)
Company Name: TargetMol Chemicals Inc.    Recommend    Complaint
Tel: +1-781-999-5354; +17819995354
Email: marketing@targetmol.com
Nationality: United States
Products Intro: Product Name:GIP (3-42), human
CAS:1802086-25-4
Package:1mg;196USD|5mg;487USD|10mg;696USD
CB Index: 58
WebSite: https://www.targetmol.com/
Related Information: Sales Network   Catalog(32467)   User Evaluation
Company Name: Aladdin Scientific    Recommend    Complaint
Tel:
Email: tp@aladdinsci.com
Nationality: United States
Products Intro: Product Name:GIP (3-42), human
CAS:1802086-25-4
Purity:98% Package:$250.9/1mg;$750.9/5mg;$1200.9/10mg;Bulk package Remarks:98%
CB Index: 58
WebSite: www.aladdinsci.com/
Related Information: Sales Network   Catalog(52923)   User Evaluation
Company Name: MedChemExpress    Recommend    Complaint
Tel: 021-58955995
Email: sales@medchemexpress.com
Nationality: United States
Products Intro: Product Name:GIP (3-42), human
CAS:1802086-25-4
CB Index: 58
WebSite: www.medchemexpress.com
Related Information: Sales Network   Catalog(6398)   User Evaluation
1
Tag: 1802086-25-4
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.