123583-37-9(H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2)

123583-37-9 Basic information More..

Product Name:	H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Synonyms:	ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;H-IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;H-ALA-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-SER-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;H2N-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;PYY (HUMAN, 3-36);PYY (3-36) (DOG, MOUSE, PORCINE, RAT);PYY (3-36) (HUMAN)
CAS:	123583-37-9
MF:	C180H278N53O54R
MW:	4048.45602
EINECS:
Mol File:	Mol File

Information Error Report

Your Email:

Browse by Nationality 123583-37-9 Suppliers

123583-37-9 Recommend Suppliers

Recommend You Select Member Companies.

Company Name:	ApexBio Technology LLC Recommend Complaint
Tel:	+1-832-696-8203
Email:	info@apexbt.com
Nationality:	United States
Products Intro:	Product Name:Peptide YY(3-36), PYY, huMan CAS:123583-37-9 Package:1Mg
CB Index:	60
WebSite:	www.apexbt.com
Related Information:	Sales Network Catalog(477) User Evaluation

Company Name:	Creative Peptides Recommend Complaint
Tel:
Email:	info@creative-peptides.com
Nationality:	United States
Products Intro:	Product Name:Peptide YY (3-36) (human) Acetate CAS:123583-37-9 Purity:>98% Package:1g; 10g;100g;1kg Remarks:APIs
CB Index:	56
WebSite:	www.creative-peptides.com
Related Information:	Sales Network Catalog(6083) User Evaluation

Company Name:	Alfa Chemistry Recommend Complaint
Tel:	+1-5166625404;
Email:	Info@alfa-chemistry.com
Nationality:	United States
Products Intro:	Product Name:Peptide yy(3-36)(human) CAS:123583-37-9
CB Index:	58
WebSite:	https://www.alfa-chemistry.com/
Related Information:	Sales Network Catalog(20000) User Evaluation

Company Name:	BOC Sciences Recommend Complaint
Tel:	16314854226; +8616314854226
Email:	inquiry@bocsci.com
Nationality:	United States
Products Intro:	Product Name:Peptide YY (3-36) human CAS:123583-37-9 Remarks:Please reach out to us for more information about custom solutions.
CB Index:	58
WebSite:	https://www.bocsci.com/
Related Information:	Sales Network Catalog(19852) User Evaluation

Company Name:	BOC Sciences Recommend Complaint
Tel:	16314854226
Email:	info@bocsci.com
Nationality:	USA
Products Intro:	Product Name:Peptide YY (3-36) human CAS:123583-37-9 Remarks:Peptide YY (3-36) human, a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding, is a NPY Y2 receptor agonist. PYY (3-36) has been associated with dose-depende
CB Index:	65
WebSite:	https://www.bocsci.com
Related Information:	Sales Network Catalog() User Evaluation

1 2 3

Tag: 123583-37-9

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.