444073-04-5((D-Ala2)-Gastric Inhibitory Polypeptide (human))

444073-04-5 Basic information More..
Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human)
Synonyms:(D-Ala2)-Gastric Inhibitory Polypeptide (human);[D-Ala2]-GIP (human);(D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt;Y(D-A)EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA
CAS:444073-04-5
MF:C22H27NO11
MW:481.44988
EINECS:
Mol File:Mol File
444073-04-5
Information Error Report
Your Email:
444073-04-5 Recommend Suppliers
Recommend You Select Member Companies.
Company Name: BOC Sciences    Recommend    Complaint
Tel: 1-631-485-4226; 16314854226
Email: info@bocsci.com
Nationality: United States
Products Intro: Product Name:[D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:>=98% by HPLC Remarks:Reach out to us for more information about custom solutions.
CB Index: 65
WebSite: https://www.bocsci.com
Related Information: Sales Network   Catalog(12952)   User Evaluation(16)
Company Name: Aladdin Scientific    Recommend    Complaint
Tel:
Email: tp@aladdinsci.com
Nationality: United States
Products Intro: Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA
CAS:444073-04-5
Purity:98% Package:$172.9/1mg;$567.9/5mg;$790.9/10mg;$1374.9/25mg;$1923.9/50mg;$2692.9/100mg;Bulk p Remarks:98%
CB Index: 58
WebSite: www.aladdinsci.com/
Related Information: Sales Network   Catalog(52923)   User Evaluation
Company Name: Tocris Bioscience    Recommend    Complaint
Tel: +44 (0) 117 916 3333
Email: customerservice@tocris.co.uk
Nationality: United Kingdom
Products Intro: Product Name:[D-Ala2]-GIP (human)
CAS:444073-04-5
CB Index: 77
WebSite: www.tocris.com
Related Information: Sales Network   Catalog(5726)   User Evaluation(2)
1
Tag: 444073-04-5
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.