123139-39-9(NEUROPEPTIDE Y (2-36) (HUMAN, RAT))

123139-39-9 Basic information More..
Product Name:NEUROPEPTIDE Y (2-36) (HUMAN, RAT)
Synonyms:H-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2;NPY (2-36) (HUMAN, RAT);NEUROPEPTIDE Y (2-36) (HUMAN, RAT);2-36-Neuropeptide Y(human);2-36-Human neuropeptide Y
CAS:123139-39-9
MF:
MW:0
EINECS:
Mol File:Mol File
123139-39-9
Information Error Report
Your Email:
Browse by Nationality 123139-39-9 Suppliers China suppliers
France(1) Germany(1) United States(4) All(6)
123139-39-9 Recommend Suppliers
Recommend You Select Member Companies.
Company Name: American Peptide Company    Recommend    Complaint
Tel: 800 926-8272
Email: sales@americanpeptide.com
Nationality: United States
Products Intro:
CB Index: 71
WebSite: www.americanpeptide.com
Related Information: Sales Network   Catalog(1718)   User Evaluation
Company Name: AnaSpec, Inc.    Recommend    Complaint
Tel: 800 452 5530
Email: service@anaspec.com
Nationality: United States
Products Intro:
CB Index: 77
WebSite: www.anaspec.com
Related Information: Sales Network   Catalog(4871)   User Evaluation
Company Name: SynPep Corporation    Recommend    Complaint
Tel: (925) 803-9250 (International)
Email: sales@synpep.com
Nationality: United States
Products Intro:
CB Index: 51
WebSite: www.synpep.com
Related Information: Sales Network   Catalog(1943)   User Evaluation
Company Name: NeoMPS SA    Recommend    Complaint
Tel: (33) 3 88 79 08 79
Email: neo@neomps.com
Nationality: France
Products Intro:
CB Index: 71
WebSite: www.neomps.com
Related Information: Sales Network   Catalog(2083)   User Evaluation
Company Name: PolyPeptide Laboratories GmbH    Recommend    Complaint
Tel: +49 5331 9561 0
Email: info@polypeptide.de
Nationality: Germany
Products Intro:
CB Index: 66
WebSite: www.polypeptide.com
Related Information: Sales Network   Catalog(408)   User Evaluation
1 2
Tag: 123139-39-9
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.