SAUVAGINE

SAUVAGINE Suppliers list
Company Name: 3B Pharmachem (Wuhan) International Co.,Ltd.  
Tel: 18930552037
Email: 3bsc@sina.com
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Company Name: Shanghai Hanhong Scientific Co.,Ltd.  
Tel: 021-54306202 13764082696
Email: info@hanhongsci.com
Company Name: Chemsky(shanghai)International Co.,Ltd.  
Tel: 021-50135380
Email: shchemsky@sina.com
Company Name: Hunan Hui Bai Shi Biotechnology Co., Ltd.  
Tel: 0731-85526065 13308475853
Email: ivy@hnhbsj.com
SAUVAGINE Basic information
Discovery Structure Receptors Synthesis and release Biological functions
Product Name:SAUVAGINE
Synonyms:M.W. 4599.31 C202H346N56O63S;H-PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;GLP-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;SAUVAGINE;SAUVAGINE (FROG);PYR-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2;PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PGLU-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2
CAS:74434-59-6
MF:C202H346N56O63S1
MW:4599.31
EINECS:
Product Categories:Peptide;CRFNeuropeptides;OthersPeptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Releasing Factors;CRF receptor and related
Mol File:Mol File
SAUVAGINE Structure
SAUVAGINE Chemical Properties
storage temp. −20°C
solubility Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc.
form Powder
Sequence{Pry}-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-Asn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2
InChIKeyILCVKEBXPLEGOY-ZLFMSJRASA-N
Safety Information
WGK Germany 3
Storage Class11 - Combustible Solids
MSDS Information
ProviderLanguage
SigmaAldrich English
SAUVAGINE Usage And Synthesis
DiscoverySauvagine was first reported in the skin of the South American frog Phyllomedusa sauvagei in 1980. Novel forms of SVG were isolated in the skin of the Mexican giant leaf frog Pachymedusa dacnicolor in 20122 and the South American orange-legged leaf frog Phyllomedusa hypochondrialis in 2015.
StructureThe sauvagines of Phyllomedusa sauvagei (PS-SVG), Pachymedusa dacnicolor (PD-SVG), and Phyllomedusa hypochondrialis (PH-SVG) comprise 40 aa, 38 aa, and 40 aa residues, respectively, with a pyroglutamate at the N-terminus and an amidated C-terminus1–3 .  The sequence identity of PS-SVG with human CRH is 63%. The sequence identities of PS-SVG with carp urotensin-I, human urocortin-I, human urocortin-II, and human urocortin-III are 50%, 35%, 20%, and 25%, respectively.  PS-SVG, Mr 4599. Soluble in water and methanol.
PS-SVG
ReceptorsTwo CRH receptors, type-1 and -2 CRH receptors (CRHR1 and CRHR2), have been identified in Xenopus laevis. PS-SVG has higher affinity to CRHR2 (Kd=0.9 nM) than to CRHR1 (Kd=51.4 nM). [Tyr0 , Gln1 , Leu17]SVG (YQL-SVG) and [Tyr0 , Gln1, Bpa17]SVG (YQB-SVG) have been identified as agonists.
Synthesis and releasePD-SVG cDNA encodes 80-aa precursors. Prepro PD-SVG consists of a signal peptide (22 aa), a spacer peptide (16 aa), a cryptic region, and a mature peptide of 38 aa residues at the C-terminus.
Biological functionsSVG stimulates ACTH release from the pituitary of rats and goldfish. In Xenopus, SVG stimulates the α-melanocyte-stimulating hormone and β-endorphin release from the pars intermedia of the pituitary. SVG in the skin is considered to be involved in chemical defense.
DescriptionSauvagine is a peptide hormone, first isolated from the skin of the South American frog Phyllomedusa sauvagei, with adrenocorticotropic hormone (ACTH)-releasing activity and antidiuretic activity.
UsesSauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands[1][2][3].
References[1] David A Lovejoy, et al. Evolution and phylogeny of the corticotropin-releasing factor (CRF) family of peptides: expansion and specialization in the vertebrates. J Chem Neuroanat. 2013 Dec;54:50-6. DOI:10.1016/j.jchemneu.2013.09.006
[2] P C Montecucchi, et al. Amino acid composition and sequence analysis of sauvagine, a new active peptide from the skin of Phyllomedusa sauvagei. Int J Pept Protein Res. 1981 Aug;18(2):113-20. DOI:10.1111/j.1399-3011.1981.tb02047.x
[3] M H Perrin, et al. Corticotropin releasing factor receptors and their ligand family. Ann N Y Acad Sci. 1999 Oct 20;885:312-28. DOI:10.1111/j.1749-6632.1999.tb08687.x
SAUVAGINE Preparation Products And Raw materials
Tag:SAUVAGINE(74434-59-6) Related Product Information
SALCOMINE Ethyl isocyanoacetate Benzyl isocyanide Aluminum acetylacetonate Tosylmethyl isocyanide COBALT(II) ACETYLACETONATE Cupric acetylacetonate Tris(2,4-pentanedionato)chroMiuM(III) Methyl isocyanoacetate 1,1,3,3-Tetramethylbutyl isocyanide tert-Butyl isocyanide Phenylselenol Ferric acetylacetonate N-Butylisocyanide 2,4-Pentanedione, silver derivative Dichloro(ethylenediamine)platinum(II) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)dysprosium(III) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)europium(III)