APELIN-36 (HUMAN) manufacturers
- APELIN-36 (HUMAN)
-
-
2026-07-15
- CAS:252642-12-9
- Min. Order: 1KG
- Purity: 98%
- Supply Ability: 1000kg
- APELIN-36 (HUMAN)
-
- $7.00
-
2020-02-17
- CAS: 252642-12-9
- Min. Order: 1KG
- Purity: 99%
- Supply Ability: 100KG
|
| | APELIN-36 (HUMAN) Basic information |
| Product Name: | APELIN-36 (HUMAN) | | Synonyms: | M.W. 4195.83 C184H297N69O43S;Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH;L-Leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine;Apelin (human);LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE;APELIN-36 (HUMAN) | | CAS: | 252642-12-9 | | MF: | C184H295N69O42R2S | | MW: | 4177.8132 | | EINECS: | | | Product Categories: | peptide;Apelin receptor | | Mol File: | 252642-12-9.mol |  |
| | APELIN-36 (HUMAN) Chemical Properties |
| storage temp. | -15°C | | solubility | DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml | | form | Lyophilized powder | | color | White to off-white | | Water Solubility | Soluble in water at 1mg/ml | | Sequence | Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe |
| | APELIN-36 (HUMAN) Usage And Synthesis |
| Uses | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3][4]. | | IC 50 | HIV-1; HIV-2 | | storage | Store at -20°C | | References | [1] Tatemoto K, Hosoya M, Habata Y, et al. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem Biophys Res Commun. 1998;251(2):471-476. DOI:10.1006/bbrc.1998.9489 [2] Medhurst AD, Jennings CA, Robbins MJ, et al. Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J Neurochem. 2003;84(5):1162-1172. DOI:10.1046/j.1471-4159.2003.01587.x [3] Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H. Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 2000;473(1):15-18. DOI:10.1016/s0014-5793(00)01487-3 [4] Galon-Tilleman H, Yang H, Bednarek MA, et al. Apelin-36 Modulates Blood Glucose and Body Weight Independently of Canonical APJ Receptor Signaling. J Biol Chem. 2017;292(5):1925-1933. DOI:10.1074/jbc.M116.748103 |
| | APELIN-36 (HUMAN) Preparation Products And Raw materials |
|