|
|
| | GRF (1-44) (porcine) Basic information |
| Product Name: | GRF (1-44) (porcine) | | Synonyms: | GRF (porcine)
SoMatocrinin (porcine), SoMatoliberin (porcine), Growth HorMone-Releasing Factor (porcine), GHRH (porcine), Growth HorMone-Releasing HorMone (porcine);SoMatocrinin (porcine), SoMatoliberin (porcine), Growth HorMone-Releasing Factor (porcine), GHRH (porcine), Growth HorMone-Releasing HorMone (porcine);GRF (porcine)|GHRF,porcine;GHRF, PORCINE;GROWTH HORMONE RELEASING FACTOR PORCINE;GROWTH HORMONE-RELEASING FACTOR (1-44) (PORCINE);YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2;GROWTH HORMONE RELEASING FACTOR (1-44), AMIDE, PORCINE | | CAS: | 88384-73-0 | | MF: | C219H365N73O66S1 | | MW: | 5108.76 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![GRF (1-44) (porcine) Structure]() |
| | GRF (1-44) (porcine) Chemical Properties |
| storage temp. | −20°C | | form | powder |
| | GRF (1-44) (porcine) Usage And Synthesis |
| Uses | GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone[1][2]. | | in vivo | GHRF, porcine (0.5 μg/kg, i.v.) increases plasma concentrations of porcine somatotropin (pST) in pigs[2].
| Animal Model: | Pigs[2] | | Dosage: | 0.5 μg/kg | | Administration: | Intravenous injection (i.v.) | | Result: | Increased plasma concentrations of porcine somatotropin (pST) in control pigs, without any pST response in pST-treated pigs. |
| | References | [1] Vigh S, et al. Interaction between hypothalamic peptides in a superfused pituitary cell system. Peptides. 1984;5 Suppl 1:241-7. DOI:10.1016/0196-9781(84)90282-1 [2] Klindt J, et al. Influence of porcine somatotropin administration and sex on glucose and endocrine responses in obese pigs. Proc Soc Exp Biol Med. 1994 Oct;207(1):48-56. DOI:10.3181/00379727-207-43790 |
| | GRF (1-44) (porcine) Preparation Products And Raw materials |
|