GIP (HUMAN)

GIP (HUMAN) Suppliers list
Company Name: 3B Pharmachem (Wuhan) International Co.,Ltd.  
Tel: 18930552037
Email: 3bsc@sina.com
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Company Name: Beijing Ouhe Technology Co., Ltd  
Tel: 13552068683 13522913783
Email: 2355560935@qq.com
Company Name: Chemsky(shanghai)International Co.,Ltd.  
Tel: 021-50135380
Email: shchemsky@sina.com
Company Name: Hunan Hui Bai Shi Biotechnology Co., Ltd.  
Tel: 0731-85526065 13308475853
Email: ivy@hnhbsj.com

GIP (HUMAN) manufacturers

  • GIP, human
  • GIP, human pictures
  • $813.00
  • 2026-07-27
  • CAS:100040-31-1
  • Purity:
  • Supply Ability: 10g
  • GIP (HUMAN)
  •  GIP (HUMAN)  pictures
  • 2025-08-22
  • CAS:100040-31-1
  • Min. Order: 1MG
  • Purity: 98%
  • Supply Ability: 20 TONS
  • GIP (HUMAN)
  •  GIP (HUMAN) pictures
  • $7.00
  • 2020-02-12
  • CAS: 100040-31-1
  • Min. Order: 1KG
  • Purity: 99%
  • Supply Ability: 100KG
GIP (HUMAN) Basic information
Description Source Background
Product Name:GIP (HUMAN)
Synonyms:H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN
CAS:100040-31-1
MF:C226H338N60O66S
MW:4983.52932
EINECS:
Product Categories:peptide;Glucagon receptor and related
Mol File:100040-31-1.mol
GIP (HUMAN) Structure
GIP (HUMAN) Chemical Properties
storage temp. −20°C
form Solid
color White to off-white
Water Solubility Soluble to 1 mg/ml in water
SequenceH-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIKeyMGXWVYUBJRZYPE-YUGYIWNOSA-N
Safety Information
WGK Germany 3
Storage Class11 - Combustible Solids
MSDS Information
ProviderLanguage
SigmaAldrich English
GIP (HUMAN) Usage And Synthesis
DescriptionGIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.
Gastric inhibitory peptide
Abbreviation: GIP
Additional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide
Chemical PropertiesHuman GIP: Mr 4983.6, theoretical pI 6.92. GIP is soluble in water, but insoluble in ethanol. GIP is inactivated by DPP-4.
HistoryGIP was originally isolated from the porcine intestinal extract on the basis of its acid inhibitory activity in dogs (gastric inhibitory polypeptide) in the early 1970s, and subsequently renamed glucose-dependent insulinotropic peptide after the finding of its physiologically important role as a potentiator of glucose-stimulated insulin secretion.
UsesGIP possessing incretin activity enhances glucosestimulated insulin release. GIP agonists are potentially useful for the treatment of diabetes. Moreover, DPP-4 inhibitors are approved for use in diabetes patients because GIP is rapidly deactivated by DPP-4.
BiosynthesisThe expression of GIP is regulated by nutrients. The administration of glucose and lipid into the rat gastrointestinal tract increases GIP mRNA levels. Circulating GIP levels are low in the fasted state and increase within minutes of food ingestion. The postprandial levels of circulating GIP are dependent on meal size. The degree to which nutrients regulate GIP secretion is speciesdependent. Fat is a more potent stimulator than carbohydrates in humans, whereas in the rodent and pig, carbohydrates are more potent than fat. Once released, GIP is rapidly deactivated by DPP-4.
ReceptorsStructure and subtype
The receptor of GIP is a seven-transmembrane GPCR that belongs to a subclass of the family B. Both the relatively long extracellular N-terminal domain and the first transmembrane domain are important for ligand binding and receptor activation. The C-terminal cytoplasmic domain of the receptor is important for receptor desensitization and internalization. Like their peptide ligands, the GIP receptor and the GLP-1 receptor exhibit high degrees of amino acid sequence identity, with similar molecular structures and signaling processes. However, GIP does not bind to the GLP-1 receptor and vice versa.
Signal transduction pathway
Ligand binding to the GIP receptor primarily activates adenylyl cyclase and increases intracellular cAMP.6 The activation of the MAP kinase pathway, the phospholipase A2 pathway, and the phosphatidylinositol 3-kinase/protein kinase B pathway have also been reported.
Agonist
[D-Ala2]-GIP is an agonist. Tirzepatide (LY3298176) is a dual agonist of GIP and GLP-1 receptors.
Antagonists
GIP(6–30), ANTGIP (GIP-(7–30)-NH2) (a truncated GIP peptide antagonist), GIP(3–30)NH2 (a truncated GIP peptide antagonist), and [Pro3]-GIP; Exendin(9–39) amide are antagonists.
storageStore at -20°C
Structure and conformationHuman GIP is a single 42-aa peptide. The structure of vertebrate GIP is well conserved and both the N-terminal and central regions are important for biological activity because truncated forms of GIP, GIP(1–39), and GIP (1–30) show a high degree of biological activity.2 The N-terminal two aa residues are cleaved off by dipeptidyl-peptidase 4 (DPP-4) in the circulation to form GIP(3–42), which has no insulinotropic activity.
DescriptionGIP Human Recombinant produced in E. coli is a single polypeptide chain containing 155 amino acids (22-153) and having a molecular mass of 17.3kDa. GIP is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
SourceEcoli
BackgroundGastric Inhibitory Polypeptide (GIP) which is a significant hormone of the enteroinsular axis has a functional profile of possible therapeutic value for type 2 diabetes. GIP is an important incretin hormone released into the circulation from endocrine K-cells of the duodenum and jejunum after ingestion of food1. GIP was evaluated for his ability to elevate cellular cAMP production. GIP promotes plasma triglyceride clearance in response to oral fat loading.
GIP (HUMAN) Preparation Products And Raw materials
Tag:GIP (HUMAN)(100040-31-1) Related Product Information
COBALT(II) ACETYLACETONATE Tosylmethyl isocyanide Cupric acetylacetonate Ethyl isocyanoacetate Aluminum acetylacetonate SALCOMINE Tris(2,4-pentanedionato)chroMiuM(III) GIP (Gastric Inhibitory polypeptide) Ferric acetylacetonate Phenylselenol tert-Butyl isocyanide 1,1,3,3-Tetramethylbutyl isocyanide Methyl isocyanoacetate N-Butylisocyanide 2,4-Pentanedione, silver derivative Dichloro(ethylenediamine)platinum(II) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)dysprosium(III) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)europium(III)