GLP-2 (HUMAN)

GLP-2 (HUMAN) Suppliers list
Company Name: 3B Pharmachem (Wuhan) International Co.,Ltd.  
Tel: 18930552037
Email: 3bsc@sina.com
Company Name: Shanghai Hanhong Scientific Co.,Ltd.  
Tel: 021-54306202 13764082696
Email: info@hanhongsci.com
Company Name: Chemsky(shanghai)International Co.,Ltd.  
Tel: 021-50135380
Email: shchemsky@sina.com
Company Name: Cellmano Biotech Limited  
Tel: 0551-65326643 18156095617
Email: info@cellmano.com
Company Name: MedChemexpress LLC  
Tel: 021-58955995
Email: sales@medchemexpress.cn

GLP-2 (HUMAN) manufacturers

  • GLP-2 (HUMAN)
  • 	GLP-2 (HUMAN) pictures
  • $7.00
  • 2020-02-14
  • CAS:223460-79-5
  • Min. Order: 1KG
  • Purity: 99%
  • Supply Ability: 100kg
GLP-2 (HUMAN) Basic information
Structure Gene, mRNA, and precursor Synthesis and release Receptors Agonists and Antagonists Biological functions Description Background
Product Name:GLP-2 (HUMAN)
Synonyms:PREPROGLUCAGON (146-179) (HUMAN) TRIFLUOROACETATE SALT;PREPROGLUCAGON (126-159) (HUMAN);PREPROGLUCAGON (146-178) (HUMAN);Glucagon-Like Peptide (GLP) II, human;HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG-OH;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
CAS:223460-79-5
MF:C165H254N44O55S
MW:3766.10906
EINECS:
Product Categories:Glucagon receptor and related
Mol File:223460-79-5.mol
GLP-2 (HUMAN) Structure
GLP-2 (HUMAN) Chemical Properties
storage temp. −20°C
solubility Soluble to 1 mg/ml in 5% NH4OH / water
form solid
color White to off-white
Water Solubility Soluble to 1 mg/ml in 5% NH4OH / water
SequenceH-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Safety Information
Safety Statements 22-24/25
WGK Germany 3
MSDS Information
ProviderLanguage
SigmaAldrich English
GLP-2 (HUMAN) Usage And Synthesis
StructureGLP-2 is a 33-aa peptide hormone, and has high sequence homology as a member of the glucagon family. The N-terminal two aa residues are cleaved off by dipeptidyl peptidase 4 (DPP-4). The N-terminal truncated GLP-2 fragment, GLP-2(3–33), acts as a competitive antagonist of the GLP-2 receptor, inhibiting nutrient- and GLP-2-induced mucosal growth in rodents. Phylogenetic analyses suggest that GLP-2 sequences have diversified most rapidly among the members of the glucagon family. Human GLP-2: Mr 3766.1, theoretical pI 4.17. GLP-2 is soluble in 5% NH4OH (-1mg/mL). GLP-2 is inactivated by DPP-4.	GLP-2 (HUMAN)
Gene, mRNA, and precursorThe human proglucagon gene, GCG, location 2q36– q37, spans approximately 9.4 kb and comprises six exons and five introns. It encodes a preproglucagon of 180 aa residues that contains glucagon, GLP-1, and GLP-2. The expression of proglucagon has been detected in the pancreatic α cells, intestinal L cells, and brain.
Synthesis and releaseGlucagon, GLP-1, and GLP-2 are processed from proglucagon in pancreatic α cells and intestinal L cells in a tissue-specific manner. Prohormone convertases (PCs) are responsible for the tissue-specific processing. In pancreatic α cells, the major bioactive hormone is glucagon cleaved by PC2, whereas in the intestinal L cells, PC1/3 liberates GLP-1 and GLP-2 as bioactive hormones. As a result, GLP-1 and GLP-2 are coreleased from intestinal L cells in a 1:1 ratio following nutrient ingestion. GLP-2 secretion is also regulated by GIP and somatostatin, a gastrin-releasing peptide, and neural stimuli in a species-specific manner.
ReceptorsThe receptor of GLP-2 (GLP2R) is a seventransmembrane GPCR that belongs to a subclass of the family B. The human GLP-2 receptor gene, GLP2R, is located on chromosome 17 (17p13.3), and the human and rat GLP-2 receptor cDNAs were cloned from the intestine and hypothalamus in 1999. The GLP-2 receptor is highly specific to GLP-2, with increased cAMP production (EC50=0.58 nM), but not to related members of the glucagon peptide family. GLP-2 activates cAMP production in rodent and human cells transfected with the rat or human GLP-2 receptor.
Agonists and Antagonists[Glycine2]-GLP-2 (a long-acting agonist), Teduglutide (a protease-resistant analog of GLP-2). There are no high-affinity specific GLP-2 receptor antagonists but GLP-2(11–33) and GLP-2(3–33) are known as antagonists.
Biological functionsCompared with GLP-1 and glucagon receptors, GLP-2 receptor expression is more restricted, occurring predominantly in the gastrointestinal tract, brain, and lung. In the rat, the GLP-2 receptor is most abundant in the jejunum, followed by the duodenum, ileum, colon, and stomach, and at very low levels in several other tissues including the central nervous system. The gastrointestinal tract, from the stomach to the colon, is the principal target for GLP-2 action. It has been suggested that GLP-2 may exert diverse actions involved mainly in the control of gastrointestinal growth and function (for example, epithelial integrity, motility, and secretion; local blood flow; and nutrient uptake and utilization). A stimulatory effect of GLP-2 on glucagon secretion from the human pancreas has also been reported. However, the GLP-2 receptor is not localized to the known target cells of GLP-2 tropic action, but to scattered enteroendocrine cells, enteric neurons, and subepithelial myofibroblasts. These results suggest that paracrine and/or neural pathways may mediate the intestinal tropic actions of GLP-2. It has been reported that GLP-2 acts through a neural pathway to affect intestinal crypt cell c-fos expression, and through a nitric oxide-dependent mechanism to affect intestinal blood flow. For GLP-2-induced epithelial growth, KGF and IGF-1, secreted from subepithelial myofibroblasts, act as essential mediators in response to GLP-2. GLP-2 receptor mRNA expression has also been found in the normal human cervix, but its functional relevance is not yet known. The GLP-2 receptor is also expressed in the central nervous system including the hypothalamus. Central GLP-2 is expected to be related to the regulation of feeding behavior. Several studies suggest that GLP2 exerts beneficial effects on glucose metabolism, especially in conditions related to the increased uptake of energy, such as obesity, at least in the animal model.
DescriptionGLP-2 is cosecreted with GLP-1 in response to nutrient ingestion. The principal role of GLP-2 appears to be the maintenance of the growth and absorptive function of the intestinal mucosal villus epithelium. GLP-2 was first identified as a novel peptide following the cloning of the proglucagon gene in the early 1980s, and subsequently the biosynthesis and release of GLP-2 were confirmed by isolation and characterization from the porcine and human small intestine. The biological role of GLP-2 as a stimulator of intestinal epithelial proliferation was first demonstrated in 1996.
UsesGLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
Clinical UseThe pharmacological application of GLP-2 has been recognized and assessed in preclinical and clinical investigations to prevent or treat a number of intestinal diseases, including short bowel syndrome, Crohn’s disease, inflammatory bowel disease, chemotherapyinduced intestinal mucositis, colon carcinogenesis, and small bowel enteritis. The US Food and Drug Administration has accepted Teduglutide, an analog of GLP-2, for use in adult patients with short bowel syndrome.
in vivo

GLP-2 quickly increases apoB48 mass in the TRL fraction of plasma, which is indicative of chylomicron number, and this is blocked by L-NAME. GLP-2 treatment alone increases postprandial TRL-lipids (slope 3.65±0.73×103 g/L/min vs 1.63±0.28×103 g/L/min, GLP-2 vs control), and this effect is completely mitigated by L-NAME pretreatment (slope 3.67±0.15×104 g/L/min). The GLP-2-induced rise in TRL-apoB48 occurres within 30 minutes and precedes the rise in TRL-TG. GLP-2 acutely increases plasma tritium levels (slope, 1.66±0.25×102 dpm/mL/min vs 1.11±0.17×102 dpm/mL/min, GLP-2 vs control)[2].

storageStore at -20°C
DescriptionGLP-2 contains 34 amino acids having a molecular mass of 3922.38 Dalton.
BackgroundGLP-2 functions as an intestinal growth factor, which stimulates intestinal epithelial growth. GLP2 is involved in diabetes-associated bowel growth. GLP2 enhances cell differentiation, playing a role as a cytokine and in tissue regeneration, and mediating cytoprotection. GLP2 is invloded numerous therapeutic applications. GLP2 regulates signaling pathways coupled to cell proliferation and cell death by apoptosis.
GLP-2 is produced by specific post-translational proteolytic cleavage of proGLP. GLP-2 is manufactured by the intestinal endocrine L cell and by several neurons in the central nervous system.
References[1] Kaori Austin, et al. IGF Binding Protein-4 is Required for the Growth Effects of Glucagon-Like Peptide-2 in Murine Intestine. Endocrinology. 2015 Feb; 156(2): 429-436. DOI:10.1210/en.2014-1829
[2] Hsieh J, et al. Glucagon-Like Peptide 2 (GLP-2) Stimulates Postprandial Chylomicron Production and Postabsorptive Release of Intestinal Triglyceride Storage Pools via Induction of Nitric Oxide Signaling in Male Hamsters and Mice. Endocrinology. 2015 Oct;156(10):3538-47. DOI:10.1210/EN.2015-1110
GLP-2 (HUMAN) Preparation Products And Raw materials
Tag:GLP-2 (HUMAN)(223460-79-5) Related Product Information
GLP-1 (HUMAN) Tosylmethyl isocyanide Benzyl isocyanide SALCOMINE Cupric acetylacetonate Aluminum acetylacetonate Tris(2,4-pentanedionato)chroMiuM(III) COBALT(II) ACETYLACETONATE Ethyl isocyanoacetate tert-Butyl isocyanide Phenylselenol Ferric acetylacetonate 1,1,3,3-Tetramethylbutyl isocyanide Methyl isocyanoacetate 2,4-Pentanedione, silver derivative Dichloro(ethylenediamine)platinum(II) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)dysprosium(III) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)europium(III)