| Conjugations | Biotin |
| Format | FITC, Unmodified |
| Source_Species | Wheat |
| Source_Species | E. coli |
| Format | Allophycocyanin, Unmodified |
| Conjugations | HRP |
| Immunogen | Synthetic peptide directed towards the middle region of Human DDB1. |
| Conjugations | FITC |
| Immunogen | Recombinant DDAH1 (Ala20-Pro215) expressed in E. coli. |
| Conjugations | Allophycocyanin, Cy7 |
| Format | Unconjugated, Unmodified |
| Epitope | Internal |
| Source_Species | Human |
| Immunogen | E. coli-derived Human DDAH1 fragment |
| Immunogen | A synthetic peptide of human DDB1. |
| Clonality | Polyclonal |
| Host | Mouse |
| Expression_System | 293T Cells |
| Format | Biotin, Unmodified |
| Immunogen | Amino acids DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR were used as the immunogen for the DDAH2 antibody. |
| Specificity | Human DDB1 |
| Format | Allophycocyanin, Cy7, Unmodified |
| Tag | GST, N-terminus |
| Format | Horseradish Peroxidase, Unmodified |
| Specificity | The antibody is a rabbit polyclonal antibody raised against DDAH1. |
| Reactivity | Human; Mouse; Rat |
| Specificity | Human DDAH / DDAH1 |
| Specificity | DDB1 Antibody detects endogenous levels of total DDB1. |
| Region | aa 1044-1140 |
| Tag | Myc-DDK -Flag |
| Host | Rabbit |
| Format | Phycoerythrin, Unmodified |
| Conjugations | Phycoerythrin |
| Conjugations | Allophycocyanin |
| Tag | His |
| Expression_System | E. coli |
| Expression_System | Wheat Germ Extract |
| Reactivity | Human |
| Specificity | Human DDAH1 |
| Epitope | aa20-215 |
| Expression_System | HEK 293 Cells |
| Immunogen | Recombinant protein of human DDAH2 |
| Immunogen | Full length human DDAH1, aa 1-285 (NP_036269.1). |
| Conjugations | Unconjugated |
| Immunogen | Full length human DDAH1, aa 1-286 (AAH33680). |
| Usage | For western blots: incubate membrane with diluted antibody overnight in 5% w/v milk , 1X TBS, 0.1% Tween-20 at 4��C with gentle shaking. |
| Species | Human |
| Description | DDAH2 antibody is an unconjugated rabbit polyclonal antibody to human DDAH2. Validated for ELISA, IF, IHC and WB. |
| Description | DDAH1 antibody is a PE-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB. |
| Description | DDAH2 antibody is an unconjugated rabbit polyclonal antibody to DDAH2 from human. It is reactive with human, mouse and rat. Validated for IF and WB. |
| Description | DDAH1 antibody is an FITC-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB. |
| Description | DDB1 antibody is an HRP-conjugated rabbit polyclonal antibody to human DDB1 (Internal). Validated for WB. |
| Description | DDAH1 antibody is an HRP-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB. |
| Description | DDAH1 antibody is an unconjugated mouse polyclonal antibody to human DDAH1. Validated for WB. |
| Description | DDAH1 antibody is an unconjugated rabbit polyclonal antibody to human DDAH1. Validated for IHC. |
| Description | DDAH1 antibody is an APC-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB. |
| Description | DDAH1 antibody is a PE-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB. |
| Description | DDAH2 antibody is an unconjugated rabbit polyclonal antibody to DDAH2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB. |
| Description | DDB1 antibody is an FITC-conjugated rabbit polyclonal antibody to human DDB1 (Internal). Validated for WB. |
| Description | DDB1 antibody is an unconjugated rabbit polyclonal antibody to DDB1 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, Peptide-ELISA and WB. |
| Description | DDAH1 antibody is a biotin-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB. |
| Description | DDAH1 antibody is an APC, Cy7-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB. |
| Application | IHC; IF; WB; Peptide-ELISA |
| Application | IHC-P; WB |
| Application | IHC; IF; WB; ELISA |
| Application | IHC-P |
| Application | IF; WB |
| Application | WB |
| Target | DDAH2 |
| Target | DDAH1 |
| Target | DDB1 |