Human EGFR protein

Human EGFR protein Suppliers list
Company Name: ACROBiosystems  
Tel: +86-15754881728
Email: yingjuan.dong@acrobiosystems.com

Human EGFR protein manufacturers

Human EGFR protein Chemical Properties
Safety Information
MSDS Information
Human EGFR protein Usage And Synthesis
ConjugationsBiotin
FormatFITC, Unmodified
Source_SpeciesWheat
Source_SpeciesE. coli
FormatAllophycocyanin, Unmodified
ConjugationsHRP
ImmunogenSynthetic peptide directed towards the middle region of Human DDB1.
ConjugationsFITC
ImmunogenRecombinant DDAH1 (Ala20-Pro215) expressed in E. coli.
ConjugationsAllophycocyanin, Cy7
FormatUnconjugated, Unmodified
EpitopeInternal
Source_SpeciesHuman
ImmunogenE. coli-derived Human DDAH1 fragment
ImmunogenA synthetic peptide of human DDB1.
ClonalityPolyclonal
HostMouse
Expression_System293T Cells
FormatBiotin, Unmodified
ImmunogenAmino acids DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR were used as the immunogen for the DDAH2 antibody.
SpecificityHuman DDB1
FormatAllophycocyanin, Cy7, Unmodified
TagGST, N-terminus
FormatHorseradish Peroxidase, Unmodified
SpecificityThe antibody is a rabbit polyclonal antibody raised against DDAH1.
ReactivityHuman; Mouse; Rat
SpecificityHuman DDAH / DDAH1
SpecificityDDB1 Antibody detects endogenous levels of total DDB1.
Regionaa 1044-1140
TagMyc-DDK -Flag
HostRabbit
FormatPhycoerythrin, Unmodified
ConjugationsPhycoerythrin
ConjugationsAllophycocyanin
TagHis
Expression_SystemE. coli
Expression_SystemWheat Germ Extract
ReactivityHuman
SpecificityHuman DDAH1
Epitopeaa20-215
Expression_SystemHEK 293 Cells
ImmunogenRecombinant protein of human DDAH2
ImmunogenFull length human DDAH1, aa 1-285 (NP_036269.1).
ConjugationsUnconjugated
ImmunogenFull length human DDAH1, aa 1-286 (AAH33680).
UsageFor western blots: incubate membrane with diluted antibody overnight in 5% w/v milk , 1X TBS, 0.1% Tween-20 at 4��C with gentle shaking.
SpeciesHuman
DescriptionDDAH2 antibody is an unconjugated rabbit polyclonal antibody to human DDAH2. Validated for ELISA, IF, IHC and WB.
DescriptionDDAH1 antibody is a PE-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB.
DescriptionDDAH2 antibody is an unconjugated rabbit polyclonal antibody to DDAH2 from human. It is reactive with human, mouse and rat. Validated for IF and WB.
DescriptionDDAH1 antibody is an FITC-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DescriptionDDB1 antibody is an HRP-conjugated rabbit polyclonal antibody to human DDB1 (Internal). Validated for WB.
DescriptionDDAH1 antibody is an HRP-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DescriptionDDAH1 antibody is an unconjugated mouse polyclonal antibody to human DDAH1. Validated for WB.
DescriptionDDAH1 antibody is an unconjugated rabbit polyclonal antibody to human DDAH1. Validated for IHC.
DescriptionDDAH1 antibody is an APC-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB.
DescriptionDDAH1 antibody is a PE-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DescriptionDDAH2 antibody is an unconjugated rabbit polyclonal antibody to DDAH2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
DescriptionDDB1 antibody is an FITC-conjugated rabbit polyclonal antibody to human DDB1 (Internal). Validated for WB.
DescriptionDDB1 antibody is an unconjugated rabbit polyclonal antibody to DDB1 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, Peptide-ELISA and WB.
DescriptionDDAH1 antibody is a biotin-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DescriptionDDAH1 antibody is an APC, Cy7-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB.
ApplicationIHC; IF; WB; Peptide-ELISA
ApplicationIHC-P; WB
ApplicationIHC; IF; WB; ELISA
ApplicationIHC-P
ApplicationIF; WB
ApplicationWB
TargetDDAH2
TargetDDAH1
TargetDDB1
Human EGFR protein Preparation Products And Raw materials
Tag:Human EGFR protein Related Product Information