GLUCAGON (1-37) (PORCINE) manufacturers
- Oxyntomodulin
-
- $0.00 / 10MG
-
2025-08-22
- CAS:62340-29-8
- Min. Order: 1MG
- Purity: 95%
- Supply Ability: 20 TONS
|
| | GLUCAGON (1-37) (PORCINE) Basic information |
| Product Name: | GLUCAGON (1-37) (PORCINE) | | Synonyms: | OXYNTOMODULIN;Oxyntomodulin (porcine, bovine);OXYNTOMODULIN (PORCINE);ENTEROGLUCAGON;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;GLUCAGON 37;GLUCAGON 1-37 | | CAS: | 62340-29-8 | | MF: | C192H295N59O60S | | MW: | 0 | | EINECS: | | | Product Categories: | peptide;Glucagon receptor and related | | Mol File: | Mol File | ![GLUCAGON (1-37) (PORCINE) Structure]() |
| | GLUCAGON (1-37) (PORCINE) Chemical Properties |
| storage temp. | Desiccate at -20°C | | form | Powder | | color | White to off-white | | Water Solubility | Soluble to 1 mg/ml in water | | Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| | GLUCAGON (1-37) (PORCINE) Usage And Synthesis |
| Uses | Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist[1]. | | storage | Store at -20°C | | References | [1] Alessandro Pocai. Action and therapeutic potential of oxyntomodulin. Mol Metab. 2013 Dec 14;3(3):241-51. DOI:10.1016/j.molmet.2013.12.001 |
| | GLUCAGON (1-37) (PORCINE) Preparation Products And Raw materials |
|