|
|
| Product Name: | DGKA Protein | | Synonyms: | DGKA Protein | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![DGKA Protein Structure]() |
| | DGKA Protein Chemical Properties |
| | DGKA Protein Usage And Synthesis |
| Immunogen | Synthetic peptide from N-Terminus of human CLIC4 (NP_039234). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Guinea pig (100%); Panda, Dog, Bovine (92%); Zebra finch (85%). | | Reactivity | Human; Mouse; Rat | | Expression_System | HEK 293 Cells | | Format | Unconjugated, Unmodified | | Conjugations | FITC | | Clonality | Polyclonal | | Expression_System | 293T Cells | | Specificity | Human CLIC4 | | Conjugations | Unconjugated | | Expression_System | E. coli | | Usage | The predicted MW is 28kDa, while the observed MW by Western blot was 29kDa. | | Region | aa 104-253 | | Epitope | N-Terminus | | Reactivity | Human; Chimpanzee; Orangutan; Gibbon; Monkey; Mouse; Rat; Guinea pig | | Tag | His | | Tag | Myc-DDK -Flag | | Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-253 of human CLIC4 (NP_039234.1). MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK | | Source_Species | Human | | Format | FITC, Unmodified | | Source_Species | E. coli | | Host | Rabbit | | Species | Rat | | Species | Human | | Description | CLIC4 antibody is an unconjugated rabbit polyclonal antibody to CLIC4 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. | | Description | CLIC4 antibody is an FITC-conjugated rabbit polyclonal antibody to CLIC4 (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB. | | Application | IHC; IHC-P; WB | | Application | IHC; IF; WB | | Target | CLIC4 |
| | DGKA Protein Preparation Products And Raw materials |
|