GLP-2 (RAT) manufacturers
- GLP-2 (RAT)
-
- $7.00
-
2020-02-14
- CAS: 195262-56-7
- Min. Order: 1KG
- Purity: 99%
- Supply Ability: 100KG
|
| | GLP-2 (RAT) Basic information |
| Product Name: | GLP-2 (RAT) | | Synonyms: | GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAGON (146-178) (RAT);PROGLUCAGON (126-158) (RAT);M.W. 3796.17 C166H256N44O56S | | CAS: | 195262-56-7 | | MF: | C166H256N44O56S | | MW: | 3796.13504 | | EINECS: | | | Product Categories: | Peptide;Glucagon receptor and related | | Mol File: | 195262-56-7.mol |  |
| | GLP-2 (RAT) Chemical Properties |
| storage temp. | -15°C | | solubility | ≥ 138.05mg/mL in DMSO | | form | Powder | | color | White to off-white | | Water Solubility | Soluble to 1 mg/ml in water | | Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
| | GLP-2 (RAT) Usage And Synthesis |
| Uses | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR)[1][2]. | | References | [1] Avik K, et, al. Is OM-3 synergistic with GLP-2 in intestinal failure. J Surg Res. 2017 Jan; 207: 7-12. DOI:10.1016/j.jss.2016.08.018
[2] Flavio GR, et, al. Glucagon-like peptide-2: divergent signaling pathways. J Surg Res. 2004 Sep; 121(1): 5-12. DOI:10.1016/j.jss.2004.04.009 |
| | GLP-2 (RAT) Preparation Products And Raw materials |
|