GALANIN, RAT manufacturers
- GALANIN, RAT
-
- $7.00 / 1KG
-
2020-02-13
- CAS:114547-31-8
- Min. Order: 1KG
- Purity: 99%
- Supply Ability: 100KG
|
| | GALANIN, RAT Basic information |
| Product Name: | GALANIN, RAT | | Synonyms: | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;GALANIN, RAT;Galanin (mouse, rat);GALANIN RATGALANIN;Rat galanin-(1-29);L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-a-aspa | | CAS: | 114547-31-8 | | MF: | C141H211N43O41 | | MW: | 3164.45 | | EINECS: | | | Product Categories: | Peptide;Galanins;Neuropeptides;Peptides for Cell Biology | | Mol File: | 114547-31-8.mol |  |
| | GALANIN, RAT Chemical Properties |
| storage temp. | −20°C | | form | powder | | color | White | | Water Solubility | Soluble to 1 mg/ml in water | | Sequence | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 |
| | GALANIN, RAT Usage And Synthesis |
| Uses | Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2]. | | storage | -20°C | | References | [1] Wang S, et al. Cloning and expressional characterization of a novel galanin receptor. Identification of different pharmacophores within galanin for the three galanin receptor subtypes. J Biol Chem. 1997;272(51):31949-31952. DOI:10.1074/jbc.272.51.31949
[2] Mazarati A, et al. Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 2006;318(2):700-708. DOI:10.1124/jpet.106.104703 |
| | GALANIN, RAT Preparation Products And Raw materials |
|