IBERIOTOXIN

IBERIOTOXIN Suppliers list
Company Name: 3B Pharmachem (Wuhan) International Co.,Ltd.  
Tel: 18930552037
Email: 3bsc@sina.com
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Company Name: Shanghai Hanhong Scientific Co.,Ltd.  
Tel: 021-54306202 13764082696
Email: info@hanhongsci.com
Company Name: Chemsky(shanghai)International Co.,Ltd.  
Tel: 021-50135380
Email: shchemsky@163.com
Company Name: Chemsky(shanghai)International Co.,Ltd.  
Tel: 021-50135380
Email: shchemsky@sina.com
IBERIOTOXIN Basic information
Product Name:IBERIOTOXIN
Synonyms:IBTX;IBTX (SCORPION, BUTHUS TAMULUS);IBERIOTOXIN;IBERIOTOXIN, BUTHUS TAMULUS;IBERIOTOXIN SCORPION BUTHUS TAMULUS;PGLU-PHE-THR-ASP-VAL-ASP-CYS-SER-VAL-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-LYS-ASP-LEU-PHE-GLY-VAL-ASP-ARG-GLY-LYS-CYS-MET-GLY-LYS-LYS-CYS-ARG-CYS-TYR-GLN [DISULFIDE BRIDGES: 7-28, 13-3, 17-3];RLBTX;PYR-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ
CAS:129203-60-7
MF:C179H274N50O55S7
MW:4230.84786
EINECS:
Product Categories:Enzyme Inhibitors;Enzyme Inhibitors by Type;Other;Potassium channel;Ion Channel Modulating Peptides;Potassium Channel ModulatorsPeptides for Cell Biology;Monovalent Ion Channels;Potassium Channel ModulatorsCell Signaling and Neuroscience;Scorpion;Toxins and Venoms;Voltage-gated Ion Channels
Mol File:129203-60-7.mol
IBERIOTOXIN Structure
IBERIOTOXIN Chemical Properties
storage temp. -20°C
solubility H2O: 1 mg/mL, clear, colorless
form Salt-free lyophilized solid
color White to off-white
Water Solubility Soluble to 0.70 mg/ml in water
Sequence{Glp}-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
InChIKeyVDNVVLOBNHIMQA-UHFFFAOYSA-N
Safety Information
Hazard Codes T+
Risk Statements 26/27/28
Safety Statements 28-36/37-45
RIDADR UN 3462 6.1/PG 2
WGK Germany 3
RTECS NH6107500
3-10
Storage Class6.1A - Combustible acute toxic Cat. 1 and 2
very toxic hazardous materials
Hazard ClassificationsAcute Tox. 1 Inhalation
Acute Tox. 2 Dermal
Acute Tox. 2 Oral
MSDS Information
ProviderLanguage
SigmaAldrich English
IBERIOTOXIN Usage And Synthesis
UsesSelective probe for high-conductance calcium-activated potassium channels.
UsesIberiotoxin is a selective and reversible inhibitor of high-conductance calcium-activated potassium channel. A toxin purified from the Eastern Indian red scorpion Buthus tamulus.
UsesIberiotoxin, recombinant from Mesobuthus tamulus has been used as an inhibitor of large-conductance calcium-activated K+ channels to study its effect on the NLRP3 (nucleotide-binding oligomerization domain-like receptor containing pyrin domain 3) inflammasome activation in bone marrow-derived macrophages (BMDMs). It has also been used to block Ca2+- activated K+ channels to determine interleukin(IL)-1β in BMDCs following inflammasome activation.
Biological Activityiberiotoxin is a 37 amino acid peptidyl toxin isolated from the scorpion mesobuthus tamulus and was shown to selectively block large conductance ca2+-activated k+ channels(bkca) in smooth muscle cells.in single channel recordings, iberiotoxin can reversibly block outward currents mediated by bkca in excised membrane patches from bovine aortic smooth muscle with an ic50 value of 250 pm. it is also a noncompetitive, partial inhibitor of charybdotoxin binding in bovine aortic sarcolemmal membrane vesicles (ki = 250 pm).[1]. galvez a, gimenez-gallego g, reuben j p, et al. purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion buthus tamulus. the journal of biological chemisty, 1990, 265(19): 11083-11090.
Biochem/physiol ActionsThe single chain peptide iberiotoxin (IbTX) is a selective and reversible inhibitor of high-conductance calcium-activated potassium channels (PK,Ca). It occurs naturally in the venom of the scorpion Buthus tamulus. IbTX also modulates the binding of charybdotoxin (CbTX) to smooth muscle sarcolemmal membranes in a non-competitive manner. IbTX is similar in size to CbTX and shares considerable sequence homology with CbTX. However, IbTX differs in its overall charge in having one fewer basic and four more acidic residues than CbTX.
in vivo

Male Wistar rats (6-7 weeks old) with chronic heart failure (CHF), Iberiotoxin (0.125 nmol/nl, 1.25 nmol/nl and 12.5 nmol/nl) is infused into paraventricular hypothalamic nucleus (PVN) by osmotic minipumps. After perfusion of Iberiotoxin by microinjection of rAAV2-KCNMB4 shRNA virus, right ventricular weight/body weight and lung weight/body weight ratio as well as left ventricular end-diastolic diameter are increased and left ventricular ejection fraction is decreased[4].

storage-20°C (desiccate)
IBERIOTOXIN Preparation Products And Raw materials
Tag:IBERIOTOXIN(129203-60-7) Related Product Information
Aluminum acetylacetonate Ethyl isocyanoacetate SALCOMINE Benzyl isocyanide Tris(2,4-pentanedionato)chroMiuM(III) Tosylmethyl isocyanide COBALT(II) ACETYLACETONATE Cupric acetylacetonate 1,1,3,3-Tetramethylbutyl isocyanide tert-Butyl isocyanide Phenylselenol Ferric acetylacetonate Methyl isocyanoacetate N-Butylisocyanide 2,4-Pentanedione, silver derivative Dichloro(ethylenediamine)platinum(II) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)dysprosium(III) Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)europium(III)