GRF (1-44) (bovine) manufacturers
- GRF
-
- $1.00
-
2026-09-14
- CAS:
- Min. Order: 1kit
- Purity: 99.9%
- Supply Ability: 100KG
|
| | GRF (1-44) (bovine) Basic information |
| Product Name: | GRF (1-44) (bovine) | | Synonyms: | GHRF BOVINE;GRF (bovine)|GRF (1-44) (BOVINE);YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2;Growth hormone releasing factor, bovine, ≥97% (HPLC);H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-GLY-ALA-LYS-VAL-ARG-LEU-NH2;GRF (1-44), AMIDE, BOVINE;GROWTH HORMONE RELEASING FACTOR BOVINE;GROWTH HORMONE-RELEASING FACTOR (1-44) (BOVINE) | | CAS: | 88894-91-1 | | MF: | C220H366N72O66S1 | | MW: | 5107.77 | | EINECS: | | | Product Categories: | Peptide | | Mol File: | Mol File | ![GRF (1-44) (bovine) Structure]() |
| | GRF (1-44) (bovine) Chemical Properties |
| storage temp. | −20°C | | form | powder |
| | GRF (1-44) (bovine) Usage And Synthesis |
| Uses | GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583)[1][2]. | | in vivo | GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) has no influence on the mRNA abundance of the liver-type glucose transporter in the liver or kidney of postpartum bovine[2].
GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) also doesn’t alter the mRNA abundance of the erythrocyte-type or the intestinal-type glucose transporter in the kidney of postpartum bovine, but results individual differences in the mRNA abundance of the intestinal-type glucose transporter in liver[2].
| | References | [1] Padmanabhan V, et al. Modulation of growth hormone-releasing factor-induced release of growth hormone from bovine pituitary cells. Domest Anim Endocrinol. 1987 Oct;4(4):243-52. DOI:10.1016/0739-7240(87)90020-8 [2] Zhao FQ, et al. Regulation of the gene expression of glucose transporter in liver and kidney of lactating cows by bovine growth hormone and bovine growth hormone-releasing factor. J Dairy Sci. 1996 Sep;79(9):1537-42. DOI:10.3168/jds.S0022-0302(96)76514-1 |
| | GRF (1-44) (bovine) Preparation Products And Raw materials |
|