PTH (28-48) (HUMAN) manufacturers
- PTH (28-48) (HUMAN)
-
- $1.00 / 1g
-
2020-03-06
- CAS:83286-22-0
- Min. Order: 1g
- Purity: ≥98%
- Supply Ability: g/kg/Ton
- PTH (28-48) (HUMAN)
-
- $1.00 / 1g
-
2020-03-06
- CAS:83286-22-0
- Min. Order: 1g
- Purity: ≥98%
- Supply Ability: g/kg/Ton
|
| | PTH (28-48) (HUMAN) Basic information |
| Product Name: | PTH (28-48) (HUMAN) | | Synonyms: | PARATHYROID HORMONE HUMAN: FRAGMENT 28-48;PARATHYROID HORMONE (28-48) (HUMAN);PTH (28-48) (HUMAN);H-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG-ASP-ALA-GLY-SER-OH;parathyroid hormone fragment 28-48 human;LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG-ASP-ALA-GLY-SER;SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: SEINFMHNLGKHLSSMERVEWLRKKLQDVHNF;Human parathormone 28-48 | | CAS: | 83286-22-0 | | MF: | C95H150N28O29 | | MW: | 2148.38 | | EINECS: | | | Product Categories: | Parathyroid Hormone Fragments;Peptides and Proteins;Peptides for Cell Biology | | Mol File: | 83286-22-0.mol |  |
| | PTH (28-48) (HUMAN) Chemical Properties |
| density | 1.48±0.1 g/cm3(Predicted) | | storage temp. | −20°C | | Sequence | Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser |
| | PTH (28-48) (HUMAN) Usage And Synthesis |
| Uses | pTH (28-48) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1]. | | References | [1] Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
| | PTH (28-48) (HUMAN) Preparation Products And Raw materials |
|