CECROPIN B manufacturers
- Cecropin B
-
-
2026-09-11
- CAS:80451-05-4
- Min. Order: 1mg
- Purity: 95%
- Supply Ability: 1000mg
- Cecropin B
-
-
2026-08-25
- CAS:80451-05-4
- Min. Order: 1kg
- Purity: >98%
- Supply Ability: 20 tons
- Cecropin B
-
- $643.00
-
2026-07-15
- CAS:80451-05-4
- Purity:
- Supply Ability: 10g
|
| | CECROPIN B Basic information |
| Product Name: | CECROPIN B | | Synonyms: | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;CECROPIN B;LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Aids096161;Aids-096161;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);Cecropin B, ≥97% (HPLC) | | CAS: | 80451-05-4 | | MF: | C176H302N52O41S | | MW: | 3834.66988 | | EINECS: | | | Product Categories: | Peptide | | Mol File: | 80451-05-4.mol |  |
| | CECROPIN B Chemical Properties |
| storage temp. | −20°C | | form | powder | | color | White to off-white | | Water Solubility | Water : 20 mg/mL (5.22 mM) | | Sequence | H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | | InChIKey | YIQHNFUJWYYSEC-MQAAYMCRSA-N |
| WGK Germany | 3 | | Storage Class | 11 - Combustible Solids |
| | CECROPIN B Usage And Synthesis |
| Uses | Cecropin B is an antibacterial peptide isolated from pig intestine and moths. | | Biological Activity | Antibacterial peptide originally identified in moths (Hyalophora cecropia) and later in pig intestine.', 'Cecropin B is known for its antimicrobial activity. It displays antitumor effects in hepatocellular carcinoma, lymphoma, and leukemia cell lines. | | in vivo | The wounds are moist with more exudation in C group, while that in other groups are dry without obvious exudation. The body temperature of the majority of the mice in each group is elevated, but the number of leucocytes in each group is lowered after operation. The quantity of bacteria in muscle in A group is obviously lower than that in M group and C group. The number of surviving mice after 4 PID in C group is evidently smaller than that in A and M groups( P<0. 05)[2]. | | IC 50 | CYP3 |
| | CECROPIN B Preparation Products And Raw materials |
|