ChemicalBook > Product Catalog >Biochemical Engineering >Inhibitors >Proteases >CJC1295

CJC1295

CJC1295 Suppliers list
Company Name: Hebei Xunou new energy Technology Co., LTD
Tel: +undefined17531957005
Email: xunou8@hbxunou.com
Products Intro: Product Name:CJC1295
CAS:863288-34-0
Purity:99 Package:1box;82USD|5box;80USD|10box;78USD
Company Name: Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
Tel: +8618068519287
Email: sales@xuanmingchem.com
Products Intro: Product Name:CJC-1295
CAS:863288-34-0
Purity:98%,99% HPLC Package:1BOX;0USD|1g;0USD
Company Name: Zhuzhou Yaozhijie Chemical Co., LTD
Tel: +8618073316972
Email: sales@goodpeptides.com
Products Intro: Product Name:CJC-1295 with DAC
CAS:863288-34-0
Purity:99.9% Package:100kits;75USD Remarks:Peptides
Company Name: Wuhan Godbullraw Chemical Co.,ltd
Tel: +undefined18986288449
Email: Alisasales@godbullraw.com
Products Intro: Product Name:CJC-1295
CAS:863288-34-0
Purity:99.0% Package:1vial;USD
Company Name: Hebei Nafu Technology Co. , Ltd.
Tel: +8615075022224
Email: 17745771666@hebeinafu.com
Products Intro: Product Name:Myo-Inositol, Cyclic 1,2:3,4:5,6-Tris
CAS:863288-34-0
Purity:99.9% Package:1kg;200USD|5kg;180USD|10kg;150USD

CJC1295 manufacturers

  • CJC1295 without DAC
  • CJC1295 without DAC pictures
  • $80.00/ kit
  • 2024-06-08
  • CAS:863288-34-0
  • Min. Order: 10kit
  • Purity: 99%
  • Supply Ability: 100kg
  • CJC 1295(without DAC)
  • CJC 1295(without DAC) pictures
  • $50.00 / 1Box
  • 2024-06-07
  • CAS:
  • Min. Order: 1Box
  • Purity: 99.99%
  • Supply Ability: 10000000000
  • CJC1295
  • CJC1295 pictures
  • $85.00 / 1box
  • 2024-06-07
  • CAS:863288-34-0
  • Min. Order: 1box
  • Purity: 99.9%
  • Supply Ability: 2000box

Related articles

CJC1295 Basic information
Product Name:CJC1295
Synonyms:CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG);CJC-1295(10mg)
CAS:863288-34-0
MF:C152H252N44O42
MW:3367.89688
EINECS:206-141-6
Product Categories:Peptides;CJC;863288-34-0
Mol File:863288-34-0.mol
CJC1295 Structure
CJC1295 Chemical Properties
Melting point > 177° C (dec.)
density 1.45
storage temp. -20°C Freezer, Under inert atmosphere
solubility Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form Solid
color White to Off-White
InChIKeyXOZMWINMZMMOBR-HRDSVTNWSA-N
Safety Information
MSDS Information
CJC1295 Usage And Synthesis
DescriptionCJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.
UsesCJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.
benefitsCJC1295 is a chemically synthesised peptide that significantly promotes the release of growth hormone by activating the pituitary gland. Receiving CJC-1295 peptide therapy has multiple benefits, including: increased metabolism and energy, decreased body fat and increased muscle mass, optimised immune system, improved bone density, improved sleep, shorter recovery time, repair of injuries, improved skin elasticity, reduced wrinkles, strengthened nails and hair, and more.
PharmacologyBy doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.
Clinical UseCJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.
Side effectsCJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.
CJC1295 Preparation Products And Raw materials
Tag:CJC1295(863288-34-0) Related Product Information
Pralmorelin Oxytocin Cetrorelix acetate motilin-related peptide Phosphorus trichloride Trifluoroacetic acid Potassium pyrophosphate Dimethyl fumarate Cinnamaldehyde Sodium sulfide L-Lysine BUSERELIN Melanotan II BPC 157 Melanotan 1 Ipamorelin Somatostatin Hexarelin