| Identification | Back Directory | [Name]
GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN | [CAS]
107444-51-9 | [Synonyms]
MKC253 GLP-17-3 107444-51-9 Glp-I (7-36) GLP-1 [7-36] GLP-1(7-36), >98% GLP-1-(7-36) amide GLP-1(7-36) acetate GLP-1 (7-36) or (7-37) Human GLP-1 (7-36)-NH2 GLP-1(7-37), IRP peptide Human GLP-1-(7-36)-amide glucagon-likepeptidei(7-36 GLP-1 (7-36) amide Acetate GLP-1 (7-36) AMIDE (HUMAN) GLP-1(7-36)?amide impurity PREPROGLUCAGON 78-107 AMIDE M.W. 3297.67 C149H226N40O45 GLUCAGON-LIKE PEPTIDE-1 [7-36] HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 PREPROGLUCAGON (78-107) AMIDE (HUMAN) GLUCAGON LIKE PEPTIDE-I (7-36) AMIDE, HUMAN GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN) GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Glucagon-like peptide 1 (7-36) amide (human, rat) glucagon-like peptide i amide fragment 7-36 human GLP-1 (7-36) amide (human, bovine, gp, mouse, rat) Glucagon-like peptide 1 (7-36) (huMan, rat, Mouse) Glucagon-Like Peptide (GLP) I (7-36), amide, human GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, RAT, MOUSE) GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLP-1 (HUMAN, 7-36 AMIDE) (BOVINE, CANINE, RAT, GUINEA PIG) GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN USP/EP/BP TIANFU CHEM GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN GLP-1(7-36),Glucagon-Like Peptide I Amide Fragment 7-36 human GLP-1(7-36)/Glucagon-like peptide 1 (7-36) aMide (huMan, rat) GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-36 AMIDE) (BOVINE, CANINE, RAT, GUINEA PIG) GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)|GLP-1 (7-36) amide(P1269) PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT PREPROGLUCAGON (98-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT GLP-1(7-36),Human GLP-1-(7-36)-amide,Insulinotropin,MKC253,Glucagon-like Peptide 1 (7-36) amide, >98% HUMAN GLP-1-(7-36)-AMIDE; INSULINOTROPIN; MKC253; GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE; GLP-1 (7-36) AMIDE HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 acetate salt Glucagon-related peptide 1 (rana catesbeiana), 3-L-glutamic acid-10-L-valine-16-glycine-17-L-glutamine-23-L-isoleucine-24-L-alanine-27-L-valine-30-L-argininamide-31-de-L-proline-32-de-L-lysine- Glucagon-Like Peptide 1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-127) aMide (huMan, bovine, guinea pig, Mouse, rat), Proglucagon (78-107) aMide (huMan, bovine, guinea pig, Mouse, rat) GLP-1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat)
Glucagon-Like Peptide 1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-127) aMide (huMan, bovine, guinea pig, Mouse, rat), Proglucagon (78-107) aMide (huMan, bovine, guin L-Argininamide, L-histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl... | [Molecular Formula]
C149H226N40O45 | [MDL Number]
MFCD00133373 | [MOL File]
107444-51-9.mol | [Molecular Weight]
3297.68 |
| Chemical Properties | Back Directory | [density ]
1.47 | [RTECS ]
LZ3980060 | [storage temp. ]
−20°C | [solubility ]
Soluble in DMSO | [form ]
powder | [color ]
White to off-white | [Water Solubility ]
Soluble in water (1 mg/ml). | [Sequence]
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 | [InChIKey]
DTHNMHAUYICORS-KTKZVXAJSA-N |
| Hazard Information | Back Directory | [Uses]
Diabetes?II?-?not?yet?an?approved?application | [Uses]
Glucagon-Like Peptide (GLP) I Amide Fragment 7-36 human has been used as a GLP-1 receptor agonist:
- in lysate transfer cyclic adenosine monophosphate (cAMP) assay to test its effect on adenylyl cyclase activity
- to pre-treat the human umbilical vein endothelial cells (HUVECs) to monitor its effect on hyperpermeability in endothelial cell (EC) monolayers and changes with the actin cytoskeleton
- to test its inhibitory effect on vascular endothelial growth factor-A (VEGFA) based vasodilation in rat mesenteric arteries
| [Uses]
Glucagon-Like Peptide-1 is used as a Effector in the hormonal control of insulin secretion. The peptide fragment is secreted from the lower small intestine. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. | [General Description]
Glucagon-like peptide 1 (GLP-1) peptide is obtained from proglucagon and is metabolically inactive. However, it is processed to two smaller amide forms, namely GLP-1 (7-37) amide and GLP-1 (7-36) amide. It is a natural gastrointestinal peptide. | [Biochem/physiol Actions]
GLP-1 (glucagon-like peptide 1) (7-36) amide is a potent insulinotropic peptide, which initiates the glucose-induced insulin release after meals or oral glucose intake. It has an anti-diabetogenic effect and thus, might have use in the treatment of non-insulin dependent diabetes mellitus. | [in vivo]
Glucagon-Like Peptide (GLP) I (7-36), amide is a physiological incretin hormone that is released after nutrient intake from the lower gut and stimulates insulin secretion at elevated plasma glucose concentrations. Exogenous GLP-1 (7-36 amide) is an effective means of normalizing fasting plasma glucose concentrations in poorly-controlled Type 2 diabetic subjects[3]. Exogenously administered GLP-1-(7–36)amide is extremely labile in vivo, with more than 80% being cleaved into GLP-1-(9–36)amide after sc or iv administration[4]. | [storage]
Store at -20°C |
|
|