| Identification | Back Directory | [Name]
Calcitonin eel | [CAS]
57014-02-5 | [Synonyms]
ASU 1-7
miacalcic
Calcitoni
Eel calcitonin
CALCITONIN, EEL
Elcatonin impurity
Eel thyrocalcitonin
THYROCALCITONIN EEL
Calcitonin (eel) (9CI)
Calcitonin eel USP/EP/BP
Calcitonin, eel, ≥97% (HPLC)
ELCATONIN ACETATE 57014-02-5
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7)
Calcitonin (salmon), 26-L-aspartic acid-27-L-valine-29-L-alanine-
H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2
cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7]
H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER- GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL- GLY-ALA-GLY-THR-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7)
Thyrocalcitonin Eel, Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7] | [EINECS(EC#)]
232-693-2 | [Molecular Formula]
C146H241N43O47S2 | [MDL Number]
MFCD00133858 | [MOL File]
57014-02-5.mol | [Molecular Weight]
3414.87 |
| Chemical Properties | Back Directory | [density ]
1.52±0.1 g/cm3(Predicted) | [storage temp. ]
−20°C
| [solubility ]
Water: 10 mg/ml | [form ]
A solid | [Sequence]
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
| Hazard Information | Back Directory | [Description]
Calcitonin eel is a peptide hormone that lowers calcium concentration in the blood. In humans, it is released by thyroid cells and acts to decrease the formation and absorptive activity of osteoclasts. Its role in regulating plasma calcium is much greater in children and in certain diseases than in normal adults. Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis. | [Biological Activity]
Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. | [Synthesis]
A method for the preparation of calcitonin eel acetate, comprising the steps of: deprotecting a RinkAmideMBHA resin with a deprotecting reagent to remove the Fmoc protecting group; using the deprotected RinkAmideMBHA resin as a starting material, and u | [in vitro]
Calcitonin, eel effectively induces a concentration-dependent stimulation of phosphoinositide hydrolysis and stimulates prolactin release compared to salmon calcitonin in cultured anterior pituitary cells.
Calcitonin, eel is inactive on the inhibition of prolactin release under thyrotropin releasing hormone (TRH) stimulated conditions. | [Structure and conformation]
Eel calcitonin has structural similarities with salmon calcitonin and, to date, research preparations have been evaluated with reference to the salmon calcitonin standard using the rat hypocalcaemia assay method. However, as salmon and eel calcitonins do have structural differences, which are likely to become evident if different in vivo or in vitro assay methods are used, a standard for eel calcitonin is required. |
| Questions And Answer | Back Directory | [Application]
Calcitonin primarily works by regulating the skeletal system, kidneys, and gastrointestinal tract, lowering blood calcium levels and improving or alleviating bone pain caused by osteoporosis.
1. Effects on bones: Calcitonin inhibits bone autolysis and resorption, reducing calcium release from bones; simultaneously, bones continuously absorb calcium from the blood, lowering blood calcium levels. It also inhibits bone salt dissolution and transfer, inhibits bone resorption, increases bone turnover, and increases urinary excretion of calcium and phosphorus, thus lowering blood calcium and phosphorus levels. For patients with osteoporosis, this product can reduce continued bone loss and decrease the incidence of fractures.
2. Inhibits the release of pain mediators, blocks their receptors, and increases β-endorphin release, resulting in peripheral and central analgesic effects.
3. Effects on the kidneys: By inhibiting the reabsorption of calcium, phosphorus, and sodium by the renal tubules, it increases their excretion in urine, but does not lower blood calcium levels below the normal range, and has minimal effect on potassium and hydrogen ions. 4. Effects on the gastrointestinal tract: It can inhibit intestinal calcium transport and suppress the secretion of gastric acid, gastrin, and insulin. Clinically, calcitonin can be used to treat osteitis deformans, osteoporosis in the elderly, and hypercalcemia caused by bone metastases. |
|
|