| Identification | Back Directory | [Name]
CRF (HUMAN, RAT) | [CAS]
86784-80-7 | [Synonyms]
CRH CRF crf41 mci028 ratcrf humancrf corticobiss CRF Acetate ratcrf(1-41) humancrf(1-41) CRF (HUMAN, RAT) CRF, HUMAN AND RAT rathypothalamiccrf CRF(human,rat), CRH CRF(human,Rat) Acetate ratacth-releasinghormone CRF (HUMAN, RAT) USP/EP/BP CRF (human, rat) acetate salt CORTICOTROPIN RELEASING FACTOR M.W. 4757.45 C208H344N60O63S2 ratcorticotropin-releasingfactor corticotropin-releasingfactor(rat) humancorticotropin-releasingfactor humancorticotropin-releasinghormone ratcorticotropin-releasingfactor-41 corticotropin-releasingfactor(horse) corticotropin-releasinghormone(human) CORTICOTROPIN RELEASING FACTOR, HUMAN humancorticotropin-releasinghormone-41 Rat/human corticotropin-releasing factor CRF-41, CRH, Corticoliberin, Corticorelin CORTICOTROPIN RELEASING FACTOR HUMAN, RAT CORTICOTROPIN RELEASING FACTOR, HUMAN AND RAT SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 CORTICOTROPIN RELEASING FACTOR (CRF), HUMAN, RAT Corticotropin-releasing factor (human)
(Human CRF) Corticotropin Releasing Factor human, rat, ≥95% (HPLC) CRF (huMan, rat)
CRF-41, CRH, Corticoliberin, Corticorelin Corticotropin-releasing Factor TFA Salt (Human, rat) (Technical Grade) CorticotropinReleasingFactorhuMan,rat,CorticotropinReleasingFactorhuMan Corticotropin Releasing Factor, Human and Rat - CAS 86784-80-7 - Calbiochem corticotropin-releasingfactor(sheep),2-l-glutamicacid-22-l-alanine-23-l-arg inine-25-l-glutamicacid-38-l-methionine-39-l-glutamicacid-41-l-isoleucinamid Ser-Glu-Glu-Pro-Pro-IleSer-Leu-Asp-Leu-Thr-Phe-His-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 Corticotropin-releasing factor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine- 25-L-glutamic acid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide- SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 H-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 acetate salt | [Molecular Formula]
C208H344N60O63S2 | [MDL Number]
MFCD00213806 | [Molecular Weight]
4757.45 |
| Chemical Properties | Back Directory | [storage temp. ]
−20°C
| [solubility ]
H2O : 16.66 mg/mL (3.50 mM; Need ultrasonic and warming) | [form ]
White to off-white lyophilized solid | [color ]
white to off-white | [biological source]
human rat | [Water Solubility ]
Soluble to 1.10 mg/ml in water |
| Hazard Information | Back Directory | [Uses]
Treatment of symptoms associated with peritumoral edema in brain tumor patients. | [Brand name]
Xerecept (Hollister-Stier) [Note—The source of the product (human, porcine, etc.) must be indicated in the labeling.]. | [General Description]
Corticotropin-releasing factor is a 41-amino-acid polypeptide. It is expressed in neurons, hypothalamus?and amygdala. | [Biochem/physiol Actions]
CRF is a hypothalamic peptide that releases ACTH and endorphin from the anterior pituitary. It is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. | [storage]
Desiccate at -20°C |
|
| Company Name: |
J & K SCIENTIFIC LTD.
|
| Telephone: |
18210857532 18210857532 |
| Website: |
https://www.jkchemical.com |
| Company Name: |
Sigma-Aldrich
|
| Telephone: |
021-61415566 800-8193336 |
| Website: |
https://www.sigmaaldrich.cn |
|