APELIN-36 (HUMAN)
- CAS No.
- 252642-12-9
- Chemical Name:
- APELIN-36 (HUMAN)
- Synonyms
- Apelin (human);Apelin-36 (tfa);APELIN-36 (HUMAN);Apelin-36|Apelin(human);Apelin-36, human - 1 mg;Apelin 36 (human) TFA salt;M.W. 4195.83 C184H297N69O43S;LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH;Apelin 36 (human), Endogenous apelin receptor (APJ) agonist
- CBNumber:
- CB1688041
- Molecular Formula:
- C184H295N69O42R2S
- Molecular Weight:
- 4177.8132
- MDL Number:
- MFCD01865608
- MOL File:
- 252642-12-9.mol
- MSDS File:
- SDS
- TDS File:
- TDS
| storage temp. | -15°C |
|---|---|
| solubility | DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml |
| form | Lyophilized powder |
| color | White to off-white |
| Water Solubility | Soluble in water at 1mg/ml |
| Sequence | Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe |
APELIN-36 (HUMAN) price More Price(31)
| Manufacturer | Product number | Product description | CAS number | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|---|
| Cayman Chemical | 13524 | Apelin-36 ≥95% | 252642-12-9 | 500μg | $199 | 2024-03-01 | Buy |
| Cayman Chemical | 13524 | Apelin-36 ≥95% | 252642-12-9 | 1mg | $378 | 2024-03-01 | Buy |
| Usbiological | 254650 | Apelin-36 (human) ~97%(HPLC) | 252642-12-9 | 1mg | $834 | 2026-06-03 | Buy |
| Biosynth | PP49914 | H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH | 252642-12-9 | 1mg | $594.94 | 2026-06-04 | Buy |
| Biosynth | PP49914 | H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH | 252642-12-9 | 10mg | $731.8 | 2026-06-04 | Buy |
APELIN-36 (HUMAN) Chemical Properties,Uses,Production
Uses
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3][4].
IC 50
HIV-1; HIV-2
storage
Store at -20°C
References
[1] Tatemoto K, Hosoya M, Habata Y, et al. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem Biophys Res Commun. 1998;251(2):471-476. DOI:10.1006/bbrc.1998.9489
[2] Medhurst AD, Jennings CA, Robbins MJ, et al. Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J Neurochem. 2003;84(5):1162-1172. DOI:10.1046/j.1471-4159.2003.01587.x
[3] Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H. Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 2000;473(1):15-18. DOI:10.1016/s0014-5793(00)01487-3
[4] Galon-Tilleman H, Yang H, Bednarek MA, et al. Apelin-36 Modulates Blood Glucose and Body Weight Independently of Canonical APJ Receptor Signaling. J Biol Chem. 2017;292(5):1925-1933. DOI:10.1074/jbc.M116.748103
APELIN-36 (HUMAN) Preparation Products And Raw materials
Raw materials
Preparation Products
APELIN-36 (HUMAN) Suppliers
| Supplier | Tel | Country | ProdList | Advantage | |
|---|---|---|---|---|---|
| 3B Pharmachem (Wuhan) International Co.,Ltd. | 18930552037 | 3bsc@sina.com | China | 15813 | 69 |
| GL Biochem (Shanghai) Ltd | 21-61263452 13641803416 | ymbetter@glbiochem.com | China | 9981 | 64 |
| Nanjing Chemlin Chemical Co., Ltd | 025-83697070 13770331960 | info@chemlin.com.cn | China | 16305 | 64 |
| Shanghai Hanhong Scientific Co.,Ltd. | 021-54306202 13764082696 | info@hanhongsci.com | China | 42917 | 64 |
| Chemsky(shanghai)International Co.,Ltd. | 021-50135380 | shchemsky@sina.com | China | 32273 | 50 |
| Cellmano Biotech Limited | 0551-65326643 18156095617 | info@cellmano.com | China | 1010 | 55 |
| Wuxi Zhongkun Biochemical Technology Co., Ltd. | 0510-85629785 18013409632; | sales@reading-chemicals.com | China | 15165 | 58 |
| Nanjing Leon Biological Technology Co., Ltd. | 025-84523390 -127; 17705183659 | sales@njleonbiotech.com | China | 5501 | 55 |
| Nanjing Peptide Biotech Ltd. | 025-58361106-805 15951641583 | zhao.xu@njpeptide.com | China | 9976 | 55 |
| Chengdu Youngshe Chemical Co., Ltd. | +86-17380623303 | Caroline@youngshechem.com | China | 4725 | 58 |
View Lastest Price from APELIN-36 (HUMAN) manufacturers
| Image | Update time | Product | Price | Min. Order | Purity | Supply Ability | Manufacturer | |
|---|---|---|---|---|---|---|---|---|
![]() |
2026-07-15 | APELIN-36 (HUMAN)
252642-12-9
|
1KG | 98% | 1000kg | Shaanxi Dideu New Materials Co. Ltd | ||
![]() |
2020-02-17 | APELIN-36 (HUMAN)
252642-12-9
|
$7.00 | 1KG | 99% | 100KG | Career Henan Chemical Co |
-

- APELIN-36 (HUMAN)
252642-12-9
- $0.00
- 98%
- Shaanxi Dideu New Materials Co. Ltd
-

- APELIN-36 (HUMAN)
252642-12-9
- $7.00
- 99%
- Career Henan Chemical Co




