ChemicalBook >> CAS DataBase List >>GALANIN, PORCINE

GALANIN, PORCINE

CAS No.
88813-36-9
Chemical Name:
GALANIN, PORCINE
Synonyms
galanin;Ccris 6750;Pig galanin;GALANIN (PIG);Porcine galanin;GALANIN, PORCINE;Porcine galanin(1-29);Galanin(1-29) porcine;Mouse Anti-GAL antibody;Rabbit Anti-GAL antibody
CBNumber:
CB3156779
Molecular Formula:
C146H213N43O40
Molecular Weight:
3210.52
MDL Number:
MFCD00133353
MOL File:
88813-36-9.mol
MSDS File:
SDS
TDS File:
TDS
Last updated:2026-04-24 14:58:27

GALANIN, PORCINE Properties

Density 1.50±0.1 g/cm3(Predicted)
RTECS LW5952050
storage temp. −20°C
form powder
color White to off-white
Water Solubility Soluble to 0.50 mg/ml in water
Sequence H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2

SAFETY

Risk and Safety Statements

WGK Germany  3

GALANIN, PORCINE price More Price(33)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Usbiological 516710 Galanin PurifiedbyProteinAaffinitychromatography. 200ug $930 2026-06-03 Buy
Biosynth FG10443 Galanin 88813-36-9 500ug $535 2026-06-04 Buy
Biosynth FG10443 Galanin 88813-36-9 1000ug $940 2026-06-04 Buy
ChemScene CS-0028037 Galanin swine 98.99% 88813-36-9 1mg $412 2026-06-04 Buy
ChemScene CS-0028037 Galanin swine 98.99% 88813-36-9 5mg $1246 2026-06-04 Buy
Product number Packaging Price Buy
516710 200ug $930 Buy
FG10443 500ug $535 Buy
FG10443 1000ug $940 Buy
CS-0028037 1mg $412 Buy
CS-0028037 5mg $1246 Buy

GALANIN, PORCINE Chemical Properties, Uses, Production

Structure

GAL is a 29-aa C-terminally amidated peptide, apart from human GAL, which has 20 aa and no amidated N-terminus. The N-terminal 1–15 aa are highly conserved.  Human proGAL: Mr 13,302.1, pI 6.84. Soluble in water and physiological saline solution.
GAL

Gene, mRNA, and precursor

The GAL gene is located on human chromosome 11q13.2, rat chromosome 1q42, and mouse chromosome 19A. The peptide precursor of GAL is encoded by a single-copy gene consisting of six small exons spanning about 6 kb of genomic DNA. Regarding its structure, a sequence of GAL is followed by the signal peptide, and the remainder is called the GAL message-associated peptide (GMAP). GAL is widely expressed in the central and peripheral nervous systems in many mammalian species. In the brain, GAL is synthesized in the dorsal raphe nucleus, locus coeruleus, rostral ventrolateral medulla, central nucleus of the amygdala, paraventricular nucleus, and supraoptic nucleus. GAL is also found in the spinal cord and gut.

Synthesis and release

GAL colocalizes in vasopressin neurons and increases during salt loading, suggesting its influence on osmotically stimulated vasopressin release. GAL gene expression in magnocellular neurons is increased by estrogen.

Receptors

GAL receptors have three subtypes, referred to as GAL receptor types 1, 2, and 3 (GALR1, GALR2, and GALR3).6 The human GALR1 gene contains three exons and is translated into a 349-aa protein. The homology between species is 93% for rat and human GALR1. The expression of GALR1 is regulated by cAMP through the transcription factor CREB. Human GALR2 has 92% sequence identity to rat GALR2, although there is a 15-aa extension of the C-terminal end in human GALR2. The GALR2 gene is expressed more ubiquitously compared with that of GALR1, as it is found in several peripheral tissues, including the pituitary gland, gastrointestinal tract, skeletal muscle, heart, kidney, uterus, ovary, and testis, in addition to the central nervous system. The Galr3 transcript was first isolated from rat hypothalamic cDNA libraries. Human GALR3 consists of 368 aa and shares 36% identity with human GALR1, 58% with human GALR2, and approximately 90% with rat GALR3.

Agonists and Antagonists

M617 (GALR1), M1153, M1145 (GALR2). M35 and galantide (nonselective GALR antagonists), RWJ-57408 (GALR1), M871 (GALR2), and SNAP37889 and SNAP398299 (GALR3).

Biological functions

In rats, GALR1 is prominently distributed in the hypothalamus, amygdala, hippocampus, thalamus, brainstem, spinal cord, dorsal root ganglion (DRG), gut, heart, lung, kidney, muscle, adipocytes, and testis. GALR2 mainly exists in the cortex, hypothalamus, hippocampus, amygdala, cerebellum, DRG, heart, liver, lung, kidney, intestine, uterus, ovary, stomach, pancreas, and testis. GALR3 is found in the hypothalamus, dorsal raphe nucleus, locus coeruleus, and amygdala. GAL is thought to regulate numerous physiological processes in the adult mammalian nervous system, including sleep/wake regulation, energy and osmotic homeostasis, reproduction, nociception, and cognition.

Clinical implications

GAL increases food intake and body weight via GALR1. Intranasal administration is an effective route for the delivery of GAL-related agents into the brain by use of various cyclodextrins. Thus, the intranasal administration of a GALR1 antagonist offers an attractive approach to combat obesity. Clinical studies indicated that the GAL concentration is correlative to the morbidity of type 2 diabetes mellitus in humans. In addition, some clinical studies have shown that the activation of the GAL pathway is effective in treating type 2 diabetes.

Description

GAL is expressed in the brain and peripheral organs, and has diverse physiological actions, including energy homeostasis, reproduction, nociception, and cognition. GAL was isolated in 1983 from the porcine intestine by Tatemoto and colleagues. The GAL peptide has been purified from the chicken, alligator, and fish species, including trout, tuna, bowfin, dogfish, and sturgeon.

Uses

Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Biological Functions

Galanin is colocalized with acetylcholine, 5-HT , and NE in neurons or in brain regions implicated in cognitive and affective behavior, suggesting a possible role in the regulation of 5-HT and NA neurotransmission in depressive states and during the course of antidepressant therapy. Three galanin receptor subtypes have been cloned and studied, but little is known about their specific contributions to behavioral processes. In the CNS, galanin inhibits acetylcholine release, suggesting a possible role for galanin in cholinergic dysfunction; inhibits neurotransmitter release and neuronal firing rate; and inhibits signal transduction by inhibition of phosphatidyl inositol hydrolysis, leading to symptoms of depression. Thus, blocking the inhibitory effects of galanin on monoamine neurotransmitters with galanin receptor antagonists would be predicted to mimic or augment the action of the other monoamine classes of antidepressants."

Clinical Use

Since its discovery in 1983, the neuropeptide galanin has been found to be involved in a wide range of functions, including pain sensation, sexual activity, feeding, and learning and memory. Galanin is widely distributed in the central and peripheral nervous systems and in the endocrine system, and it acts as a inhibitory neuromodulator of NE and 5-HT in the brain. The 29- to 30-amino-acid sequence of galanin is conserved (almost 90% among species), indicating the importance of the molecule among species.

References

[1] Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21(3):109-117. DOI:10.1016/s0165-6147(00)01446-2
[2] Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229(2):233-237. DOI:10.1016/0014-5793(88)81131-1

GALANIN, PORCINE Preparation Products And Raw materials

Raw materials

Preparation Products

GALANIN, PORCINE Suppliers

Global Suppliers ( 154)
Supplier Tel Email Country ProdList Advantage
3B Pharmachem (Wuhan) International Co.,Ltd. 18930552037 3bsc@sina.com China 15813 69
GL Biochem (Shanghai) Ltd 21-61263452 13641803416 ymbetter@glbiochem.com China 9981 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202 13764082696 info@hanhongsci.com China 42917 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380 shchemsky@sina.com China 32273 50
Cellmano Biotech Limited 0551-65326643 18156095617 info@cellmano.com China 1010 55
Wuxi Zhongkun Biochemical Technology Co., Ltd. 0510-85629785 18013409632; sales@reading-chemicals.com China 15165 58
Shanghai Xilong Biochemical Technology Co., Ltd. 021-52907766-8042 China 9928 58
Nanjing Leon Biological Technology Co., Ltd. 025-84523390 -127; 17705183659 sales@njleonbiotech.com China 5501 55
Nanjing Peptide Biotech Ltd. 025-58361106-805 15951641583 zhao.xu@njpeptide.com China 9976 55
Chengdu Youngshe Chemical Co., Ltd. +86-17380623303 Caroline@youngshechem.com China 4726 58

View Latest Price from GALANIN, PORCINE manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
	GALANIN, PORCINE pictures 2020-02-19 GALANIN, PORCINE
88813-36-9
$7.00 1KG 99% 100kg Career Henan Chemical Co
GALANIN PORCINEGALANIN POR H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2 GALANIN (PIG) GALANIN, PORCINE GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2 GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 Ccris 6750 Galanin(1-29) porcine L-Alaninamide, glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-alpha-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-histidyl-L-alpha-aspartyl-L-lysyl-L-tyrosylglycyl-L-leucyl- Porcine galanin Porcine galanin(1-29) Pig galanin Gly-L-Trp-L-Thr-L-Leu-L-Asn-L-Ser-L-Ala-Gly-L-Tyr-L-Leu-L-Leu-Gly-L-Pro-L-His-L-Ala-L-Ile-L-Asp-L-Asn-L-His-L-Arg-L-Ser-L-Phe-L-His-L-Asp-L-Lys-L-Tyr-Gly-L-Leu-L-Ala-NH2 Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-LLe-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2 galanin Glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-histidyl-L-a-aspartyl-L-lysyl- Galanin, porcine, ≥97% (HPLC) GALANIN, PORCINE USP/EP/BP Mouse Anti-GAL antibody Rabbit Anti-GAL antibody Galanin (porcine), Endogenous galanin receptor agonist 88813-36-9 C146H213N43O40 多肽抗原 小鼠抗大、小鼠、鸡、猪、牛多克隆抗体 Peptides Gastrointestinal Products Galanins BioChemical Biochemicals and Reagents Amino Acids and Peptides Peptide Galanins Neuropeptides Peptides for Cell Biology