ChemicalBook >> CAS DataBase List >>peptide 74

peptide 74

peptide 74 structure

CAS No.: 132116-39-3

Chemical Name:: peptide 74

Synonyms: 5:PN:WO0168053 SEQID:7 claimed protein;L-Asparagine, L-threonyl-L-methionyl-L-arginyl-L-lysyl-L-prolyl-L-arginyl-L-cysteinylglycyl-L-asparaginyl-L-prolyl-L-α-aspartyl-L-valyl-L-alanyl- (9CI)

CBNumber:: CB41389885

Molecular Formula:: C62H107N23O20S2

Molecular Weight:: 1558.8

MDL Number:: MFCD00237214

MOL File:: 132116-39-3.mol

MSDS File:: SDS

TDS File:: TDS

Last updated:2026-04-24 14:58:18

Request For Quotation

peptide 74 Properties

form	Solid
color	White to off-white
InChIKey	DAZBILQQVFBVPE-MCQHVSNWNA-N

peptide 74 price

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Biosynth	FP110319	Peptide 74	132116-39-3	2000ug	$900	2026-06-04	Buy
Biosynth	FP110319	Peptide 74	132116-39-3	1000ug	$900	2026-06-04	Buy
Biosynth	FP110319	Peptide 74	132116-39-3	500ug	$900	2026-06-04	Buy
Biosynth	FP110319	Peptide 74	132116-39-3	5000ug	$1750	2026-06-04	Buy
Biosynth	FP110319	Peptide 74	132116-39-3	10000ug	$3100	2026-06-04	Buy

Product number	Packaging	Price	Buy
FP110319	2000ug	$900	Buy
FP110319	1000ug	$900	Buy
FP110319	500ug	$900	Buy
FP110319	5000ug	$1750	Buy
FP110319	10000ug	$3100	Buy

peptide 74 Chemical Properties, Uses, Production

Description

Peptide 74 is a synthetic peptide that contains the sequence immediately upstream of the cleavage site of the 72-kDa type IV collagenase and other members of the matrix metalloproteinase family; inhibits the activated form of this enzyme.

Uses

Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro[1].

Definition

Peptide 74 is a synthetic peptide that has gained attention in the field of biomedical research. It has demonstrated potential applications in various areas, including drug discovery, proteomics, and immunology. Peptide 74 shows promise as an inhibitor or activator of specific biological pathways or protein-protein interactions. As with any experimental compound, caution should be exercised when handling and using Peptide 74. Safety measures such as wearing appropriate protective equipment and following proper laboratory protocols are recommended. Storage guidelines typically involve keeping the peptide at low temperatures, such as -20°C or below, to maintain its stability and activity.

References

[1] A Melchiori, et al. Inhibition of tumor cell invasion by a highly conserved peptide sequence from the matrix metalloproteinase enzyme prosegment. Cancer Res. 1992 Apr 15;52(8):2353-6. PMID:1313744
[2] P P Lee, et al. Functional role of matrix metalloproteinases (MMPs) in mammary epithelial cell development. J Cell Physiol. 2001 Jul;188(1):75-88. DOI:10.1002/jcp.1090

peptide 74 Preparation Products And Raw materials

Raw materials

Preparation Products

peptide 74 Suppliers

Global Suppliers ( 29)

Supplier	Tel	Email	Country	ProdList	Advantage
Shanghai Hanhong Scientific Co.,Ltd.	021-54306202 13764082696	info@hanhongsci.com	China	42917	64
Chemsky (shanghai) International Co.,Ltd	021-50135380	shchemsky@sina.com	China	15350	60
Creative Peptides		info@creative-peptides.com	United States	6083	56
Nanjing Leon Biological Technology Co., Ltd.	025-84523390 -127; 17705183659	sales@njleonbiotech.com	China	5501	55
Nanjing Peptide Biotech Ltd.	025-58361106-805 15951641583	zhao.xu@njpeptide.com	China	9976	55
Chengdu Youngshe Chemical Co., Ltd.	+86-17380623303	Caroline@youngshechem.com	China	4725	58
Hangzhou Peptidego Biotech Co.,Ltd.	0571-87213919 15967184799	Eric@peptidego.com	China	7872	58
Nanjing Meihao Pharmaceutical Technology Co., Ltd.	meitaochem@126.com	meitaochem@126.com	China	19087	58
Alfa Chemistry	+1-5166625404;	Info@alfa-chemistry.com	United States	20000	58
Chengdu Peter-like Biotechnology Co., Ltd.	18108052721	2850505130@qq.com	China	5037	58

Supplier	Advantage
Shanghai Hanhong Scientific Co.,Ltd.	64
Chemsky (shanghai) International Co.,Ltd	60
Creative Peptides	56
Nanjing Leon Biological Technology Co., Ltd.	55
Nanjing Peptide Biotech Ltd.	55
Chengdu Youngshe Chemical Co., Ltd.	58
Hangzhou Peptidego Biotech Co.,Ltd.	58
Nanjing Meihao Pharmaceutical Technology Co., Ltd.	58
Alfa Chemistry	58
Chengdu Peter-like Biotechnology Co., Ltd.	58

View Latest Price from peptide 74 manufacturers

Image	Update time	Product	Price	Min. Order	Purity	Supply Ability	Manufacturer
	2024-04-02	peptide 74 132116-39-3	$2.00	1kg	99%	200kg	Wuhan Xinhao Biotechnology Co., Ltd

peptide 74
132116-39-3
$2.00
99%
Wuhan Xinhao Biotechnology Co., Ltd

132116-39-3 (peptide 74) Related Search:

H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH Peptide T PEPTIDE F (BOVINE) Peptide 5 FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF

peptide 78 Peptide M peptide 74

1of2

L-Asparagine, L-threonyl-L-methionyl-L-arginyl-L-lysyl-L-prolyl-L-arginyl-L-cysteinylglycyl-L-asparaginyl-L-prolyl-L-α-aspartyl-L-valyl-L-alanyl- (9CI) 5:PN:WO0168053 SEQID:7 claimed protein 132116-39-3 C62H107N23O20S2