ChemicalBook >> CAS DataBase List >>Parathyroid hormone (1-34), rat

Parathyroid hormone (1-34), rat

CAS No.
98614-76-7
Chemical Name:
Parathyroid hormone (1-34), rat
Synonyms
RPTH 1-34;PTH (1-34) (RAT);PubChem ID: 129316189;Rat parathyroid hormone 1-34;Parathyroid hormone (1-34), rat;AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF;Parathyroid hormone (1-34) (rat) TFA;parathyroid hormone fragment 1-34 rat;PARATHYROID HORMONE RAT: FRAGMENT 1-34;PARATHYROID HORMONE (1-34), RAT USP/EP/BP
CBNumber:
CB4297390
Molecular Formula:
C180H291N55O48S2
Molecular Weight:
4057.70624
MDL Number:
MFCD00149015
MOL File:
98614-76-7.mol
MSDS File:
SDS
TDS File:
TDS
Last updated:2026-09-12 18:52:44

Parathyroid hormone (1-34), rat Properties

storage temp. −20°C
solubility Soluble in DMSO
form powder
color Off-white to light yellow
Water Solubility Soluble in water or 0.1% acetic acid.
Sequence Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
UNSPSC Code 51111800
NACRES NA.77

SAFETY

Risk and Safety Statements

PPE Eyeshields, Gloves, type N95 (US)
WGK Germany  3
Storage Class 11 - Combustible Solids

Parathyroid hormone (1-34), rat price More Price(19)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich P3921 Parathyroid Hormone Fragment 1-34 rat ≥97% (HPLC), powder 98614-76-7 0.1mg $220.15 2026-04-30 Buy
Sigma-Aldrich 512585 Parathyroid Hormone 1-34, Rat 98614-76-7 100μg $164 2025-07-31 Buy
Biosynth FP109497 pTH (1-34) (rat) 98614-76-7 2000ug $900 2026-06-04 Buy
Biosynth FP109497 pTH (1-34) (rat) 98614-76-7 1000ug $900 2026-06-04 Buy
Biosynth FP109497 pTH (1-34) (rat) 98614-76-7 500ug $900 2026-06-04 Buy
Product number Packaging Price Buy
P3921 0.1mg $220.15 Buy
512585 100μg $164 Buy
FP109497 2000ug $900 Buy
FP109497 1000ug $900 Buy
FP109497 500ug $900 Buy

Parathyroid hormone (1-34), rat Chemical Properties, Uses, Production

Uses

Parathyroid Hormone Fragment 1-34 rat has been used to study the in vivo effect of parathyroid hormone (PTH) on the intestinal HCO3-secretion in rats. It has also been injected into rats to increase PTH levels and study its effect on the high-phosphate diet-induced elevation of blood pressure.

Biochem/physiol Actions

Parathyroid Hormone Fragment 1-34 is a parathyroid hormone (PTH) analog. It is implicated in the stimulation of intracellular cAMP accumulation and it induces osteocalcin (OC) promoter activity.

in vivo

Parathyroid hormone (1-34) (rat) (s.c; 40 mg/kg; per day; for 4 weeks) promotes the formation of bone[1].

Animal Model:ovariectomized (Ovx) rats[1]
Dosage:40 mg/kg
Administration:s.c, per day, for 4 weeks
Result:Preserved Cn-BV/TV and trabecular connectivity, and combined estrogen and PTH caused a 40% increment in Cn-BV/TV while maintaining comparable trabecular connectivity with that seen in the Shamoperated animals.
Prevented further loss of connectivity and Cn-BV/TV, and combined estrogen and PTH resulted in as much as a 300% improvement in one of the parameters of trabecular connectivity, node to node strut length, and a 106% increase in Cn-BV/TV, with respect to the bone status at the initiation of treatment.

storage

Store at -20°C

Parathyroid hormone (1-34), rat Preparation Products And Raw materials

Raw materials

Preparation Products

Parathyroid hormone (1-34), rat Suppliers

Global Suppliers ( 91)
Supplier Tel Email Country ProdList Advantage
GL Biochem (Shanghai) Ltd 21-61263452 13641803416 ymbetter@glbiochem.com China 9981 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202 13764082696 info@hanhongsci.com China 42917 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380 shchemsky@sina.com China 32273 50
Cellmano Biotech Limited 0551-65326643 18156095617 info@cellmano.com China 1010 55
Sigma-Aldrich 021-61415566 800-8193336 orderCN@merckgroup.com China 51389 80
Shanghai YuanYe Biotechnology Co., Ltd. 15026964105 2881489226@qq.com China 89667 60
Nanjing Leon Biological Technology Co., Ltd. 025-84523390 -127; 17705183659 sales@njleonbiotech.com China 5501 55
Nanjing Peptide Biotech Ltd. 025-58361106-805 15951641583 zhao.xu@njpeptide.com China 9976 55
Chengdu Youngshe Chemical Co., Ltd. +86-17380623303 Caroline@youngshechem.com China 4726 58
Hangzhou Peptidego Biotech Co.,Ltd. 0571-87213919 15967184799 Eric@peptidego.com China 7872 58
SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG pTH (1-34) (rat)|PARATHYROID HORMONE (1-34),RAT PTH (1-34) (RAT) PARATHYROID HORMONE RAT: FRAGMENT 1-34 RPTH 1-34 H-ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF parathyroid hormone fragment 1-34 rat ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE RAT H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys PubChem ID: 129316189 Rat parathyroid hormone 1-34 PARATHYROID HORMONE (1-34), RAT USP/EP/BP Parathyroid hormone (1-34) (rat) TFA Parathyroid hormone (1-34), rat 98614-76-7 C180H291N55O48S2 BioChemical Cell Biology Cell Signaling and Neuroscience Hormones Other Protein/Peptide Hormones Parathyroid Hormone (PTH) Cytokines, Growth Factors and Hormones peptide Parathyroid Hormone (PTH)Peptides and Proteins Parathyroid Hormone Fragments Hormones Other Protein/Peptide Hormones Peptides for Cell Biology