Parathyroid hormone (1-34), rat
- CAS No.
- 98614-76-7
- Chemical Name:
- Parathyroid hormone (1-34), rat
- Synonyms
- RPTH 1-34;PTH (1-34) (RAT);PubChem ID: 129316189;Rat parathyroid hormone 1-34;Parathyroid hormone (1-34), rat;AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF;Parathyroid hormone (1-34) (rat) TFA;parathyroid hormone fragment 1-34 rat;PARATHYROID HORMONE RAT: FRAGMENT 1-34;PARATHYROID HORMONE (1-34), RAT USP/EP/BP
- CBNumber:
- CB4297390
- Molecular Formula:
- C180H291N55O48S2
- Molecular Weight:
- 4057.70624
- MDL Number:
- MFCD00149015
- MOL File:
- 98614-76-7.mol
- MSDS File:
- SDS
- TDS File:
- TDS
| storage temp. | −20°C |
|---|---|
| solubility | Soluble in DMSO |
| form | powder |
| color | Off-white to light yellow |
| Water Solubility | Soluble in water or 0.1% acetic acid. |
| Sequence | Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe |
| UNSPSC Code | 51111800 |
| NACRES | NA.77 |
SAFETY
Risk and Safety Statements
| PPE | Eyeshields, Gloves, type N95 (US) |
|---|---|
| WGK Germany | 3 |
| Storage Class | 11 - Combustible Solids |
Parathyroid hormone (1-34), rat price More Price(19)
| Manufacturer | Product number | Product description | CAS number | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|---|
| Sigma-Aldrich | P3921 | Parathyroid Hormone Fragment 1-34 rat ≥97% (HPLC), powder | 98614-76-7 | 0.1mg | $220.15 | 2026-04-30 | Buy |
| Sigma-Aldrich | 512585 | Parathyroid Hormone 1-34, Rat | 98614-76-7 | 100μg | $164 | 2025-07-31 | Buy |
| Biosynth | FP109497 | pTH (1-34) (rat) | 98614-76-7 | 2000ug | $900 | 2026-06-04 | Buy |
| Biosynth | FP109497 | pTH (1-34) (rat) | 98614-76-7 | 1000ug | $900 | 2026-06-04 | Buy |
| Biosynth | FP109497 | pTH (1-34) (rat) | 98614-76-7 | 500ug | $900 | 2026-06-04 | Buy |
Parathyroid hormone (1-34), rat Chemical Properties, Uses, Production
Uses
Parathyroid Hormone Fragment 1-34 rat has been used to study the in vivo effect of parathyroid hormone (PTH) on the intestinal HCO3-secretion in rats. It has also been injected into rats to increase PTH levels and study its effect on the high-phosphate diet-induced elevation of blood pressure.
Biochem/physiol Actions
Parathyroid Hormone Fragment 1-34 is a parathyroid hormone (PTH) analog. It is implicated in the stimulation of intracellular cAMP accumulation and it induces osteocalcin (OC) promoter activity.
in vivo
Parathyroid hormone (1-34) (rat) (s.c; 40 mg/kg; per day; for 4 weeks) promotes the formation of bone[1].
| Animal Model: | ovariectomized (Ovx) rats[1] |
| Dosage: | 40 mg/kg |
| Administration: | s.c, per day, for 4 weeks |
| Result: | Preserved Cn-BV/TV and trabecular connectivity, and combined estrogen and PTH caused a 40% increment in Cn-BV/TV while maintaining comparable trabecular connectivity with that seen in the Shamoperated animals. Prevented further loss of connectivity and Cn-BV/TV, and combined estrogen and PTH resulted in as much as a 300% improvement in one of the parameters of trabecular connectivity, node to node strut length, and a 106% increase in Cn-BV/TV, with respect to the bone status at the initiation of treatment. |
storage
Store at -20°C
Parathyroid hormone (1-34), rat Preparation Products And Raw materials
Raw materials
Preparation Products
Parathyroid hormone (1-34), rat Suppliers
| Supplier | Tel | Country | ProdList | Advantage | |
|---|---|---|---|---|---|
| GL Biochem (Shanghai) Ltd | 21-61263452 13641803416 | ymbetter@glbiochem.com | China | 9981 | 64 |
| Shanghai Hanhong Scientific Co.,Ltd. | 021-54306202 13764082696 | info@hanhongsci.com | China | 42917 | 64 |
| Chemsky(shanghai)International Co.,Ltd. | 021-50135380 | shchemsky@sina.com | China | 32273 | 50 |
| Cellmano Biotech Limited | 0551-65326643 18156095617 | info@cellmano.com | China | 1010 | 55 |
| Sigma-Aldrich | 021-61415566 800-8193336 | orderCN@merckgroup.com | China | 51389 | 80 |
| Shanghai YuanYe Biotechnology Co., Ltd. | 15026964105 | 2881489226@qq.com | China | 89667 | 60 |
| Nanjing Leon Biological Technology Co., Ltd. | 025-84523390 -127; 17705183659 | sales@njleonbiotech.com | China | 5501 | 55 |
| Nanjing Peptide Biotech Ltd. | 025-58361106-805 15951641583 | zhao.xu@njpeptide.com | China | 9976 | 55 |
| Chengdu Youngshe Chemical Co., Ltd. | +86-17380623303 | Caroline@youngshechem.com | China | 4726 | 58 |
| Hangzhou Peptidego Biotech Co.,Ltd. | 0571-87213919 15967184799 | Eric@peptidego.com | China | 7872 | 58 |
98614-76-7 (Parathyroid hormone (1-34), rat) Related Search:
1of4




