Parathyroid hormone (1-34), bovine
- CAS No.
- 12583-68-5
- Chemical Name:
- Parathyroid hormone (1-34), bovine
- Synonyms
- TERIPARATIDE;BPTH 1-34;parathyroid hormone fragment 1-34 bovine;Teriparatide -678;PTH (1-34) (BOVINE);bovineparathyroidhormone(1-34;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;Parathyroid hormone (1-34), bovine;PARATHYROID HORMONE BOVINE: FRAGMENT 1-34;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
- CBNumber:
- CB9284467
- Molecular Formula:
- C183H288N54O50S2
- Molecular Weight:
- 4108.71
- MDL Number:
- MFCD00147847
- MOL File:
- Mol file
- MSDS File:
- SDS
- TDS File:
- TDS
| storage temp. | −20°C |
|---|---|
| solubility | ≥410.9 mg/mL in DMSO; ≥43.8 mg/mL in H2O; ≥64.6 mg/mL in EtOH |
| form | powder |
| color | White to off-white |
| FDA UNII | 10T9CSU89I |
| Proposition 65 List | Teriparatide |
| ATC code | H05AA02 |
Parathyroid hormone (1-34), bovine price More Price(24)
| Manufacturer | Product number | Product description | CAS number | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|---|
| Sigma-Aldrich | P3671 | Parathyroid Hormone Fragment 1-34 bovine ≥97% (HPLC), powder | 12583-68-5 | 0.1mg | $390 | 2026-04-30 | Buy |
| ChemScene | CS-0029126 | Parathyroid Hormone (1-34), bovine 99.88% | 12583-68-5 | 5mg | $260 | 2026-06-04 | Buy |
| ChemScene | CS-0029126 | Parathyroid Hormone (1-34), bovine 99.88% | 12583-68-5 | 10mg | $390 | 2026-06-04 | Buy |
| ApexBio Technology | A1114 | Parathyroid Hormone (1-34), bovine | 12583-68-5 | 1mg | $100 | 2026-05-06 | Buy |
| ApexBio Technology | A1114 | Parathyroid Hormone (1-34), bovine | 12583-68-5 | 5mg | $300 | 2026-05-06 | Buy |
Parathyroid hormone (1-34), bovine Chemical Properties, Uses, Production
Description
Parathyroid hormone (PTH) is an 84 amino acid hormone involved in calcium regulation in counteraction to calcitonin. PTH regulates serum phosphate levels and vitamin D biosynthesis. N-terminal peptides of PTH are used to elicit and study a wide variety of responses in target cells.
Uses
Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis[1].
Clinical Use
Active fragment (1-34) of endogenous human
parathyroid hormone:
Treatment of osteoporosis in postmenopausal
women and men at increased risk of fractures
Treatment of corticosteroid-induced osteoporosis
Side effects
Teriparatide, parathyroid hormone (1–34), is the only anabolic agent available in the United States for the treatment of postmenopausal osteoporosis. Side effects that human should report to doctor or health care professional as soon as possible:
allergic reactions like skin rash, itching or hives, swelling of the face, lips, or tongue
blood in the urine; pain in the lower back or side; pain when urinating
signs and symptoms of low blood pressure like dizziness; feeling faint or lightheaded, falls; unusually weak or tired
signs and symptoms of increased calcium like nausea; vomiting; constipation; low energy; or muscle weakness
in vivo
Parathyroid Hormone (1-34)(subcutaneousinjection; 80 μg/kg; 5 days) increases serum osteocalcin concentrations without changing serum inorganic phosphate or calcium concentrations in either group of old animals.Serum 1,25-dihydroxyvitamin D concentrations are significantly higher in the PTH-treated senile female rats than the sex-matchedvehicle-treated controls[1].
Metabolism
No metabolism or excretion studies have been performed. Peripheral metabolism of PTH is believed to occur by non-specific enzymatic mechanisms in the liver followed by excretion via the kidneys. The 24-hour urine excretion of calcium was reduced by a clinically unimportant amount (15%).
References
[1] B H Mitlak, et al. Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. J Bone Miner Res. 1992 May;7(5):479-84. DOI:10.1002/jbmr.5650070503
[2] M Takigawa, et al. Studies on chondrocytes from mandibular condylar cartilage, nasal septal cartilage, and spheno-occipital synchondrosis in culture. I. Morphology, growth, glycosaminoglycan synthesis, and responsiveness to bovine parathyroid hormone (1-34). J Dent Res. 1984 Jan;63(1):19-22. DOI:10.1177/00220345840630010201
Parathyroid hormone (1-34), bovine Preparation Products And Raw materials
Raw materials
Preparation Products
| Supplier | Tel | Country | ProdList | Advantage | |
|---|---|---|---|---|---|
| Shenzhen Zhaoke Biotechnology Co., Ltd | 18271904430 | 1070737105@qq.com | China | 149 | 58 |
| Jiangshan Chuangsheng Bioengineering Co., Ltd | 13775204409 13775204409 | 164866523@qq.com | China | 208 | 58 |
| GL Biochem (Shanghai) Ltd | 21-61263452 13641803416 | ymbetter@glbiochem.com | China | 9981 | 64 |
| Shanghai Hanhong Scientific Co.,Ltd. | 021-54306202 13764082696 | info@hanhongsci.com | China | 42917 | 64 |
| Chemsky(shanghai)International Co.,Ltd. | 021-50135380 | shchemsky@sina.com | China | 32273 | 50 |
| Cellmano Biotech Limited | 0551-65326643 18156095617 | info@cellmano.com | China | 1010 | 55 |
| Nanjing Sunlida Biological Technology Co., Ltd. | 025-57798810 18652991625 | sales@sunlidabio.com | China | 3223 | 55 |
| ApexBio Technology LLC | +1-832-696-8203 | info@apexbt.com | United States | 477 | 60 |
| Wuxi Zhongkun Biochemical Technology Co., Ltd. | 0510-85629785 18013409632; | sales@reading-chemicals.com | China | 15165 | 58 |
| AdooQ Bioscience CHINA | 025-58849295 | info@adooq.cn | China | 2981 | 60 |
View Latest Price from Parathyroid hormone (1-34), bovine manufacturers
| Image | Update time | Product | Price | Min. Order | Purity | Supply Ability | Manufacturer | |
|---|---|---|---|---|---|---|---|---|
![]() |
2026-09-17 | Teriparatide
12583-68-5
|
$5.00 | 1Box | 99.99% | 20000 boxes | Hebei Jiafan Trading Company Limited | |
![]() |
2026-09-17 | Teriparatide
12583-68-5
|
1Gram | 98% | 50KG | Hangzhou Hyper Chemicals Limited | ||
![]() |
2026-09-15 | Teriparatide -678
12583-68-5
|
$10.00 | 1box | 99.99 | 1000000 box | Shanghai Zheng Peptide Plastic Co., Ltd. |
-

- Teriparatide
12583-68-5
- $5.00
- 99.99%
- Hebei Jiafan Trading Company Limited
-

- Teriparatide
12583-68-5
- 98%
- Hangzhou Hyper Chemicals Limited
-

- Teriparatide -678
12583-68-5
- $10.00
- 99.99
- Shanghai Zheng Peptide Plastic Co., Ltd.
12583-68-5 (Parathyroid hormone (1-34), bovine) Related Search:
1of4




