ChemicalBook >> CAS DataBase List >>(Tyr27)-alpha-cgrp (27-37) (rat)

(Tyr27)-alpha-cgrp (27-37) (rat)

(Tyr27)-alpha-cgrp (27-37) (rat) structure

CAS No.: 124501-79-7

Chemical Name:: (Tyr27)-alpha-cgrp (27-37) (rat)

Synonyms: YVPTNVGSEAF-NH2;Rat[Tyr0]CGRP-(28-37);[TYR0]-ALPHA-CGRP (28-37) (RAT);(Tyr27)-alpha-cgrp (27-37) (rat);[Tyr27]-a-CGRP (27-37) (canine, mouse, rat);(Tyr27)-α-CGRP (27-37) (canine, mouse, rat);(Tyr2?)-α-CGRP (27-37) (canine, mouse, rat);(Tyr??)-α-CGRP (27-37) (canine, mouse, rat);TYR-VAL-PRO-THR-ASN-VAL-GLY-SER-GLU-ALA-PHE-NH2;(TYR27)-ALPHA-CGRP (27-37) (CANINE, MOUSE, RAT)

CBNumber:: CB8668716

Molecular Formula:: C54H79N13O17

Molecular Weight:: 1182.28

MDL Number:: MFCD00079838

MOL File:: 124501-79-7.mol

MSDS File:: SDS

TDS File:: TDS

Last updated:2026-09-12 18:55:49

Request For Quotation

(Tyr27)-alpha-cgrp (27-37) (rat) Properties

Boiling point	1681.8±65.0 °C(Predicted)
Density	1.344±0.06 g/cm3(Predicted)
storage temp.	-15°C
pka	4.43±0.10(Predicted)
Sequence	Tyr-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2

(Tyr27)-alpha-cgrp (27-37) (rat) price

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Biosynth	VAC-00929	[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)		5mg	$299.5	2026-06-05	Buy
Biosynth	VAC-00929	[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)		10mg	$499.1	2026-06-05	Buy
Biosynth	VAC-00929	[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)		25mg	$998.25	2026-06-05	Buy
Biosynth	FT109516	(Tyr27)-alpha-CGRP (27-37) (canine, mouse, rat)	124501-79-7	1000ug	$900	2026-06-04	Buy
Biosynth	FT109516	(Tyr27)-alpha-CGRP (27-37) (canine, mouse, rat)	124501-79-7	500ug	$900	2026-06-04	Buy

Product number	Packaging	Price	Buy
VAC-00929	5mg	$299.5	Buy
VAC-00929	10mg	$499.1	Buy
VAC-00929	25mg	$998.25	Buy
FT109516	1000ug	$900	Buy
FT109516	500ug	$900	Buy

(Tyr27)-alpha-cgrp (27-37) (rat) Chemical Properties, Uses, Production

Uses

(Tyr27)-α-CGRP (27-37) (canine, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1].

References

[1] Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.

(Tyr27)-alpha-cgrp (27-37) (rat) Preparation Products And Raw materials

Raw materials

Preparation Products

(Tyr27)-alpha-cgrp (27-37) (rat) Suppliers

Global Suppliers ( 55)

Supplier	Tel	Email	Country	ProdList	Advantage
GL Biochem (Shanghai) Ltd	21-61263452 13641803416	ymbetter@glbiochem.com	China	9981	64
Shanghai Hanhong Scientific Co.,Ltd.	021-54306202 13764082696	info@hanhongsci.com	China	42917	64
Chemsky (shanghai) International Co.,Ltd	021-50135380	shchemsky@sina.com	China	15350	60
Cellmano Biotech Limited	0551-65326643 18156095617	info@cellmano.com	China	1010	55
Wuxi Zhongkun Biochemical Technology Co., Ltd.	0510-85629785 18013409632;	sales@reading-chemicals.com	China	15165	58
Creative Peptides		info@creative-peptides.com	United States	6083	56
Nanjing Leon Biological Technology Co., Ltd.	025-84523390 -127; 17705183659	sales@njleonbiotech.com	China	5501	55
Nanjing Peptide Biotech Ltd.	025-58361106-805 15951641583	zhao.xu@njpeptide.com	China	9976	55
Chengdu Youngshe Chemical Co., Ltd.	+86-17380623303	Caroline@youngshechem.com	China	4724	58
Hangzhou Peptidego Biotech Co.,Ltd.	0571-87213919 15967184799	Eric@peptidego.com	China	7872	58

Supplier	Advantage
GL Biochem (Shanghai) Ltd	64
Shanghai Hanhong Scientific Co.,Ltd.	64
Chemsky (shanghai) International Co.,Ltd	60
Cellmano Biotech Limited	55
Wuxi Zhongkun Biochemical Technology Co., Ltd.	58
Creative Peptides	56
Nanjing Leon Biological Technology Co., Ltd.	55
Nanjing Peptide Biotech Ltd.	55
Chengdu Youngshe Chemical Co., Ltd.	58
Hangzhou Peptidego Biotech Co.,Ltd.	58

124501-79-7 ((Tyr27)-alpha-cgrp (27-37) (rat)) Related Search:

(Tyr15)-acth (7-15) H-Tyr-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2 (Tyr1)-TRAP-7 (TYR11)-SOMATOSTATIN-14 (TYR15)-FIBRINOPEPTIDE B

(Tyr27)-PTH (27-48) (human) alpha-Cgrp (32-37) (rat) alpha-Cgrp (30-37) (rat) alpha-Cgrp (29-37) (rat) (Tyr12)-somatostatin-28 (1-14)

alpha-Cgrp (31-37) (rat) (Tyr27)-alpha-cgrp (27-37) (rat) alpha-Cgrp (33-37) (rat) Val-Gly-Ser-Glu Calcitonin

1of3

[TYR0]-ALPHA-CALCITONIN GENE RELATED PEPTIDE (28-37) (RAT) [TYR0] CALCITONIN GENE RELATED PEPTIDE (28-37), RAT (TYR27)-ALPHA-CALCITONIN GENE-RELATED PEPTIDE (27-37) (RAT) [TYR0]-ALPHA-CGRP (28-37) (RAT) TYR-VAL-PRO-THR-ASN-VAL-GLY-SER-GLU-ALA-PHE-NH2 H-TYR-VAL-PRO-THR-ASN-VAL-GLY-SER-GLU-ALA-PHE-NH2 (TYR27)-ALPHA-CGRP (27-37) (CANINE, MOUSE, RAT) TYR-SER-CYS-ASN-THR-ALA-THR-CYS-VAL-THR-HIS-ARG-LEU-ALA-GLY-LEU-LEU-SER-ARG-SER-GLY-GLY-VAL-VAL-LYS-ASP-ASN-PHE-VAL-PRO-THR-ASN-VAL-GLY-SER-GLU-ALA-PHE-NH2: YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 [Tyr27]-a-CGRP (27-37) (canine, mouse, rat) L-Phenylalaninamide, L-tyrosyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-α-glutamyl-L-alanyl- (9CI) Rat[Tyr0]CGRP-(28-37) (Tyr27)-α-CGRP (27-37) (canine, mouse, rat) (Tyr2?)-α-CGRP (27-37) (canine, mouse, rat) (Tyr??)-α-CGRP (27-37) (canine, mouse, rat) YVPTNVGSEAF-NH2 (Tyr27)-alpha-cgrp (27-37) (rat) 124501-79-7 C54H79N13O17