Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> (GLN11)-AMYLOID BETA-PROTEIN (1-28)

(GLN11)-AMYLOID BETA-PROTEIN (1-28)

(GLN11)-AMYLOID BETA-PROTEIN (1-28) price.
  • $190 - $2918.9
  • Product name: (GLN11)-AMYLOID BETA-PROTEIN (1-28)
  • CAS: 106686-61-7
  • MF: C145H210N42O45
  • MW: 3261.47
  • EINECS:
  • MDL Number:MFCD00133078
  • Synonyms:BETA-AMYLOID PEPTIDE (1-40, GLN11), HUMAN;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLN-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-OH;(GLN11)-AMYLOID BETA-PROTEIN (1-28);[GLN11]-BETA-AMYLOID (1-28);[GLN11]-BETA-AMYLOID (1-40);DAEFRHDSGYQVHHQKLVFFAEDVGSNK;DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV;(gln11)-amyloid B-protein fragment 1-28
18 prices
Selected condition:
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • Biorbyt Ltd
  • Biosynth
  • Thermo Scientific Chemicals
Package
  • 0.5MG
  • 500ug
  • 1000ug
  • 1mg
  • 2000ug
  • 5000ug
  • 5mg
  • 10000ug
  • 10mg
  • Manufactureraablocks
  • Product numberAA008RQQ
  • Product description(GLN11)-AMYLOID BETA-PROTEIN (1-28) >95%
  • Packaging1mg
  • Price$382
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA008RQQ
  • Product description(GLN11)-AMYLOID BETA-PROTEIN (1-28)
  • Packaging5mg
  • Price$1263
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA008RQQ
  • Product description(GLN11)-AMYLOID BETA-PROTEIN (1-28)
  • Packaging10mg
  • Price$2032
  • Updated2026-05-28
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0000148
  • Product description[GLN11]-BETA-AMYLOID (1-28) 95.00%
  • Packaging0.5MG
  • Price$658.35
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364078
  • Product description[Gln11]-Beta-Amyloid (1-40) > 95%
  • Packaging5mg
  • Price$1951.6
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364078
  • Product description[Gln11]-Beta-Amyloid (1-40) > 95%
  • Packaging10mg
  • Price$2918.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00314
  • Product description[Gln11]-beta-Amyloid (1-40)
  • Packaging10mg
  • Price$2783
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00315
  • Product description[Gln11]-beta-Amyloid (1-28)
  • Packaging10mg
  • Price$1557.9
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00314
  • Product description[Gln11]-beta-Amyloid (1-40)
  • Packaging5mg
  • Price$1669.8
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberFG108659
  • Product description(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
  • Packaging10000ug
  • Price$1900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00315
  • Product description[Gln11]-beta-Amyloid (1-28)
  • Packaging5mg
  • Price$934.75
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberFG108659
  • Product description(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
  • Packaging5000ug
  • Price$1100
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00314
  • Product description[Gln11]-beta-Amyloid (1-40)
  • Packaging1mg
  • Price$556.6
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberFG108659
  • Product description(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
  • Packaging2000ug
  • Price$560
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG108659
  • Product description(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
  • Packaging500ug
  • Price$190
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00315
  • Product description[Gln11]-beta-Amyloid (1-28)
  • Packaging1mg
  • Price$311.58
  • Updated2026-06-05
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA008RQQ (GLN11)-AMYLOID BETA-PROTEIN (1-28) >95% 1mg $382 2026-05-28 Buy
aablocks AA008RQQ (GLN11)-AMYLOID BETA-PROTEIN (1-28) 5mg $1263 2026-05-28 Buy
aablocks AA008RQQ (GLN11)-AMYLOID BETA-PROTEIN (1-28) 10mg $2032 2026-05-28 Buy
American Custom Chemicals Corporation PEP0000148 [GLN11]-BETA-AMYLOID (1-28) 95.00% 0.5MG $658.35 2021-12-16 Buy
Biorbyt Ltd orb364078 [Gln11]-Beta-Amyloid (1-40) > 95% 5mg $1951.6 2021-12-16 Buy
Biorbyt Ltd orb364078 [Gln11]-Beta-Amyloid (1-40) > 95% 10mg $2918.9 2021-12-16 Buy
Biosynth VAC-00314 [Gln11]-beta-Amyloid (1-40) 10mg $2783 2026-06-05 Buy
Biosynth VAC-00315 [Gln11]-beta-Amyloid (1-28) 10mg $1557.9 2026-06-05 Buy
Biosynth VAC-00314 [Gln11]-beta-Amyloid (1-40) 5mg $1669.8 2026-06-05 Buy
Biosynth FG108659 (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt 10000ug $1900 2026-06-04 Buy
Biosynth VAC-00315 [Gln11]-beta-Amyloid (1-28) 5mg $934.75 2026-06-05 Buy
Biosynth FG108659 (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt 5000ug $1100 2026-06-04 Buy
Biosynth VAC-00314 [Gln11]-beta-Amyloid (1-40) 1mg $556.6 2026-06-05 Buy
Biosynth FG108659 (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt 2000ug $560 2026-06-04 Buy
Biosynth FG108659 (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt 500ug $190 2026-06-04 Buy
Biosynth VAC-00315 [Gln11]-beta-Amyloid (1-28) 1mg $311.58 2026-06-05 Buy

Properties

Density :1.52±0.1 g/cm3(Predicted)
storage temp. :-15°C
form :Solid
Water Solubility :Soluble in water at 1mg/ml

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

[Gln11] Amyloid beta (1-28) Aβ(s) peptides, their peptide fragments and mutated fragments are used to study a wide range of metabolic and regulatory functions including activation of kinases, regulation of cholesterol transport, function as a transcription factor, and regulators of inflammation. Aβ(s) peptides and their peptide fragments are also used to study oxidative stress, metal binding and mechanisms of protein cross-linking in the context of diseases such as Alzheimer?s disease and neurodegeneration.