H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
|
- $91 - $1992.4
- Product name: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
- CAS: 123583-37-9
- MF: C180H278N53O54R
- MW: 4048.45602
- EINECS:
- MDL Number:MFCD00165623
- Synonyms:ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;H-IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;H-ALA-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-SER-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;H2N-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;PYY (HUMAN, 3-36);PYY (3-36) (DOG, MOUSE, PORCINE, RAT);PYY (3-36) (HUMAN)
29 prices
Selected condition:
Brand
- aablocks
- ApexBio Technology
- Arctom
- Biorbyt Ltd
- Biosynth
- Cayman Chemical
- ChemScene
- Tocris
Package
- 0.5mg
- 500μg
- 1mg
- 5mg
- 10mg
- 25mg
- 50mg
- 100mg
- 500U
- Manufactureraablocks
- Product numberAA01EAPB
- Product descriptionPeptide YY (3-36) (human) trifluoroacetate salt H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 trifluoroacetate salt 96%
- Packaging1mg
- Price$169
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAPB
- Product descriptionPeptide YY (3-36) (human) trifluoroacetate salt H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 trifluoroacetate salt ≥98%
- Packaging10mg
- Price$214
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAPB
- Product descriptionPeptide YY (3-36) (human) trifluoroacetate salt H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 trifluoroacetate salt ≥98%
- Packaging50mg
- Price$709
- Updated2026-05-30
- Buy
- ManufacturerApexBio Technology
- Product numberA1115
- Product descriptionPeptide YY(3-36), PYY, human
- Packaging25mg
- Price$877
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1115
- Product descriptionPeptide YY(3-36), PYY, human
- Packaging1mg
- Price$103
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1115
- Product descriptionPeptide YY(3-36), PYY, human
- Packaging5mg
- Price$260
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1115
- Product descriptionPeptide YY(3-36), PYY, human
- Packaging10mg
- Price$418
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P10000
- Product descriptionPeptide YY (PYY) (3-36), Human 98.00%
- Packaging5mg
- Price$228
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P10000
- Product descriptionPeptide YY (PYY) (3-36), Human 98.00%
- Packaging1mg
- Price$91
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P10000
- Product descriptionPeptide YY (PYY) (3-36), Human 98.00%
- Packaging10mg
- Price$366
- Updated2026-05-26
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372695
- Product descriptionPeptide YY (3-36) > 95%
- Packaging1mg
- Price$627.3
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372694
- Product descriptionPeptide YY (3-36) > 95%
- Packaging1mg
- Price$627.3
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372695
- Product descriptionPeptide YY (3-36) > 95%
- Packaging5mg
- Price$1331.1
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372694
- Product descriptionPeptide YY (3-36) > 95%
- Packaging5mg
- Price$1331.1
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372695
- Product descriptionPeptide YY (3-36) > 95%
- Packaging10mg
- Price$1992.4
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372694
- Product descriptionPeptide YY (3-36) > 95%
- Packaging10mg
- Price$1992.4
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAPB | Peptide YY (3-36) (human) trifluoroacetate salt H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 trifluoroacetate salt 96% | 1mg | $169 | 2026-05-30 | Buy |
| aablocks | AA01EAPB | Peptide YY (3-36) (human) trifluoroacetate salt H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 trifluoroacetate salt ≥98% | 10mg | $214 | 2026-05-30 | Buy |
| aablocks | AA01EAPB | Peptide YY (3-36) (human) trifluoroacetate salt H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 trifluoroacetate salt ≥98% | 50mg | $709 | 2026-05-30 | Buy |
| ApexBio Technology | A1115 | Peptide YY(3-36), PYY, human | 25mg | $877 | 2026-05-06 | Buy |
| ApexBio Technology | A1115 | Peptide YY(3-36), PYY, human | 1mg | $103 | 2026-05-06 | Buy |
| ApexBio Technology | A1115 | Peptide YY(3-36), PYY, human | 5mg | $260 | 2026-05-06 | Buy |
| ApexBio Technology | A1115 | Peptide YY(3-36), PYY, human | 10mg | $418 | 2026-05-06 | Buy |
| Arctom | HY-P10000 | Peptide YY (PYY) (3-36), Human 98.00% | 5mg | $228 | 2026-05-26 | Buy |
| Arctom | HY-P10000 | Peptide YY (PYY) (3-36), Human 98.00% | 1mg | $91 | 2026-05-26 | Buy |
| Arctom | HY-P10000 | Peptide YY (PYY) (3-36), Human 98.00% | 10mg | $366 | 2026-05-26 | Buy |
| Biorbyt Ltd | orb372695 | Peptide YY (3-36) > 95% | 1mg | $627.3 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372694 | Peptide YY (3-36) > 95% | 1mg | $627.3 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372695 | Peptide YY (3-36) > 95% | 5mg | $1331.1 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372694 | Peptide YY (3-36) > 95% | 5mg | $1331.1 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372695 | Peptide YY (3-36) > 95% | 10mg | $1992.4 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372694 | Peptide YY (3-36) > 95% | 10mg | $1992.4 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :≥405 mg/mL in DMSO; ≥59.2 mg/mL in EtOH; ≥64.9 mg/mL in H2O
form :lyophilized powder
color :White to off-white
Sequence :Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
InChIKey :AUHJXHCVECGTKR-DRAHMRISNA-N
solubility :≥405 mg/mL in DMSO; ≥59.2 mg/mL in EtOH; ≥64.9 mg/mL in H2O
form :lyophilized powder
color :White to off-white
Sequence :Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
InChIKey :AUHJXHCVECGTKR-DRAHMRISNA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Related product price
-
PEPTIDE YY, HUMAN
$76-3000 -
PEPTIDE YY, PORCINE
$830.72-1622.5 -
126339-09-1
$120-3598.06
Suppliers and manufacturers
Nanjing TGpeptide Biotechnology Co.,Ltd.
Hangzhou Peptidego Biotech Co.,Ltd.
3B Pharmachem (Wuhan) International Co.,Ltd.
GL Biochem (Shanghai) Ltd
Chemsky(shanghai)International Co.,Ltd.
Hunan Hui Bai Shi Biotechnology Co., Ltd.
Cellmano Biotech Limited
ApexBio Technology LLC
Wuxi Zhongkun Biochemical Technology Co., Ltd.
AdooQ Bioscience CHINA




