Amyloid β-Protein (1-42) (mouse, rat)
|
|
- $91 - $5841
- Product name: Amyloid β-Protein (1-42) (mouse, rat)
- CAS: 166090-74-0
- MF: C203H311N55O60S
- MW: 0
- EINECS:
- MDL Number:MFCD00163049
- Synonyms:ASP-ALA-GLU-PHE-GLY-HIS-ASP-SER-GLY-PHE-GLU-VAL-ARG-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA;BAP 1-42;BETA-AMYLOID, SODIUM SALT;Beta-Amyloid Peptide (1-42), mouse, rat;AMyloid b-Protein (1-42) (Mouse, rat);PREDOMINANT AMYLOID B-PROTEIN FRAGMENT;767: PN: US20090175821 SEQID: 961 claimed protein;Amyloid beta-peptide (1-42) (rat)
25 prices
Selected condition:
Brand
- Arctom
- Biorbyt Ltd
- Biosynth
- ChemScene
- Sigma-Aldrich
- Tocris
- Usbiological
Package
- .25 mg
- 100ug
- 250ug
- 0.5mg
- 500ug
- 1mg
- 2mg
- 5mg
- 10mg
- 100mg
- 500U
- 0.25 mg
- 500??g
- ManufacturerArctom
- Product numberHY-P1388
- Product descriptionβ-Amyloid (1-42), (rat/mouse) 98.87%
- Packaging500??g
- Price$190
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1388
- Product descriptionβ-Amyloid (1-42), (rat/mouse) 98.87%
- Packaging1mg
- Price$304
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1388
- Product descriptionβ-Amyloid (1-42), (rat/mouse) 98.87%
- Packaging10mg
- Price$1710
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1388
- Product descriptionβ-Amyloid (1-42), (rat/mouse) 98.87%
- Packaging5mg
- Price$1140
- Updated2026-05-26
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb99483
- Product descriptionbeta-Amyloid (1-42) Greater than 98 % purified
- Packaging0.5mg
- Price$433.5
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb99484
- Product descriptionbeta-Amyloid (1-42) Greater than 98 % purified
- Packaging1mg
- Price$671.5
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberPP40152
- Product descriptionH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
- Packaging1mg
- Price$682.64
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPP40152
- Product descriptionH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
- Packaging10mg
- Price$842.3
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging2mg
- Price$953.04
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging1mg
- Price$454.3
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging500ug
- Price$315
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging100ug
- Price$91
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging250ug
- Price$180
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging100mg
- Price$5841
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPP40152
- Product descriptionH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
- Packaging100mg
- Price$1861
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109673
- Product descriptionAmyloid b-Protein (1-42) (mouse, rat)
- Packaging10mg
- Price$1947
- Updated2026-06-04
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Arctom | HY-P1388 | β-Amyloid (1-42), (rat/mouse) 98.87% | 500??g | $190 | 2026-05-26 | Buy |
| Arctom | HY-P1388 | β-Amyloid (1-42), (rat/mouse) 98.87% | 1mg | $304 | 2026-05-26 | Buy |
| Arctom | HY-P1388 | β-Amyloid (1-42), (rat/mouse) 98.87% | 10mg | $1710 | 2026-05-26 | Buy |
| Arctom | HY-P1388 | β-Amyloid (1-42), (rat/mouse) 98.87% | 5mg | $1140 | 2026-05-26 | Buy |
| Biorbyt Ltd | orb99483 | beta-Amyloid (1-42) Greater than 98 % purified | 0.5mg | $433.5 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb99484 | beta-Amyloid (1-42) Greater than 98 % purified | 1mg | $671.5 | 2021-12-16 | Buy |
| Biosynth | PP40152 | H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH | 1mg | $682.64 | 2026-06-04 | Buy |
| Biosynth | PP40152 | H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH | 10mg | $842.3 | 2026-06-04 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 2mg | $953.04 | 2021-12-16 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 1mg | $454.3 | 2026-06-04 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 500ug | $315 | 2021-12-16 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 100ug | $91 | 2021-12-16 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 250ug | $180 | 2021-12-16 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 100mg | $5841 | 2026-06-04 | Buy |
| Biosynth | PP40152 | H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH | 100mg | $1861 | 2026-06-04 | Buy |
| Biosynth | FA109673 | Amyloid b-Protein (1-42) (mouse, rat) | 10mg | $1947 | 2026-06-04 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Related product price
-
beta-Amyloid (1-42) human
$91-5841 -
AMYLOID BETA-PROTEIN (29-40)
$138-2388.5 -
144189-71-9
$58.3-2388.5




