Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> CECROPIN A

CECROPIN A

CECROPIN A price.
  • $115 - $2159
  • Product name: CECROPIN A
  • CAS: 80451-04-3
  • MF: C184H313N53O46
  • MW: 4003.78152
  • EINECS:
  • MDL Number:MFCD00130752
  • Synonyms:LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;CECROPIN A;CECROPIN A, PORCINE;H-LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2;Cecropin A?/Cecropin A, porcine
32 prices
Selected condition:
Brand
  • aablocks
  • AK Scientific
  • Biorbyt Ltd
  • Biosynth
  • ChemScene
  • Sigma-Aldrich
  • Thermo Scientific Chemicals
  • TRC
  • Usbiological
Package
  • 0.1mg
  • 100μg
  • 500ug
  • 0.5mg
  • 1mg
  • 1000ug
  • 2mg
  • 2000ug
  • 5mg
  • 5000ug
  • 10000ug
  • 10mg
  • 100mg
  • Manufactureraablocks
  • Product numberAA00G2KG
  • Product descriptionCecropin A >98%
  • Packaging1mg
  • Price$202
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA00G2KG
  • Product descriptionCecropin A >98%
  • Packaging5mg
  • Price$535
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA00G2KG
  • Product descriptionCecropin A >98%
  • Packaging10mg
  • Price$758
  • Updated2026-05-28
  • Buy
  • ManufacturerAK Scientific
  • Product numberG883
  • Product descriptionCecropin A
  • Packaging1mg
  • Price$270
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364493
  • Product descriptionCecropin A > 95%
  • Packaging1mg
  • Price$678.3
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364493
  • Product descriptionCecropin A > 95%
  • Packaging5mg
  • Price$1443.3
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364493
  • Product descriptionCecropin A > 95%
  • Packaging10mg
  • Price$2159
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberPP44392
  • Product descriptionCecropin A
  • Packaging10mg
  • Price$242
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberPP44392
  • Product descriptionCecropin A
  • Packaging1mg
  • Price$206.25
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A
  • Packaging10000ug
  • Price$2100
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
  • Packaging10mg
  • Price$1200
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A
  • Packaging5000ug
  • Price$1250
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
  • Packaging5mg
  • Price$690
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A
  • Packaging2000ug
  • Price$620
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
  • Packaging2mg
  • Price$345
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC108878
  • Product descriptionCecropin A
  • Packaging1000ug
  • Price$370
  • Updated2026-06-04
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA00G2KG Cecropin A >98% 1mg $202 2026-05-28 Buy
aablocks AA00G2KG Cecropin A >98% 5mg $535 2026-05-28 Buy
aablocks AA00G2KG Cecropin A >98% 10mg $758 2026-05-28 Buy
AK Scientific G883 Cecropin A 1mg $270 2021-12-16 Buy
Biorbyt Ltd orb364493 Cecropin A > 95% 1mg $678.3 2021-12-16 Buy
Biorbyt Ltd orb364493 Cecropin A > 95% 5mg $1443.3 2021-12-16 Buy
Biorbyt Ltd orb364493 Cecropin A > 95% 10mg $2159 2021-12-16 Buy
Biosynth PP44392 Cecropin A 10mg $242 2026-06-04 Buy
Biosynth PP44392 Cecropin A 1mg $206.25 2026-06-04 Buy
Biosynth FC108878 Cecropin A 10000ug $2100 2026-06-04 Buy
Biosynth FC108878 Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 10mg $1200 2021-12-16 Buy
Biosynth FC108878 Cecropin A 5000ug $1250 2026-06-04 Buy
Biosynth FC108878 Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 5mg $690 2021-12-16 Buy
Biosynth FC108878 Cecropin A 2000ug $620 2026-06-04 Buy
Biosynth FC108878 Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 2mg $345 2021-12-16 Buy
Biosynth FC108878 Cecropin A 1000ug $370 2026-06-04 Buy

Properties

storage temp. :-20°C
form :powder
color :White to off-white
Water Solubility :Water : ≥ 50 mg/mL (12.14 mM)
Sequence :H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
InChIKey :HCQPHKMLKXOJSR-IRCPFGJUSA-N

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Cecropin A has been used as an antimicrobial peptide (AMP):
  • to test its cytotoxic effect on breast adenocarcinoma (MDA-MB-231) and human mesothelioma (M14K) cell lines
  • in ultrasensitive radial diffusion assay against E coli to test Galleria mellonella protein 24 and apolipophorin III effects
  • to test its minimal inhibitory concentrations (MICs) in sensitivity assay for Photorhabdus variants


Related product price